KEGG   Martelella mediterranea: Mame_01110Help
Entry
Mame_01110        CDS       T04757                                 

Gene name
adhT
Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mmed  Martelella mediterranea
Pathway
mmed00010  Glycolysis / Gluconeogenesis
mmed00071  Fatty acid degradation
mmed00350  Tyrosine metabolism
mmed00625  Chloroalkane and chloroalkene degradation
mmed00626  Naphthalene degradation
mmed01100  Metabolic pathways
mmed01110  Biosynthesis of secondary metabolites
mmed01120  Microbial metabolism in diverse environments
mmed01130  Biosynthesis of antibiotics
mmed01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mame_01110 (adhT)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mame_01110 (adhT)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Mame_01110 (adhT)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mame_01110 (adhT)
   00626 Naphthalene degradation
    Mame_01110 (adhT)
Enzymes [BR:mmed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mame_01110 (adhT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C APS_kinase
Motif
Other DBs
NCBI-ProteinID: AQZ50481
UniProt: A0A1U9YYF8
LinkDB All DBs
Position
complement(1205870..1206895)
Genome map
AA seq 341 aa AA seqDB search
MEKTMKAAVVRQFGKPLVMEEVAVPSVGPGQILVKMAASGVCHTDLHAAEGDWPIKPEPP
FIPGHEGVGHVVAVGAGVSHVKEGDRVGVPWLYTACGCCKHCLGGWETLCEAQQNTGYSV
NGSFAEYVLADPNYVGHLPDNVSFTEIAPILCAGVTVYKGLKVTDTKPGDWVVISGIGGL
GHLAVQYAKAMGLNVLAVDIDDAKLDLAKRLGASLAVNARNADPVAFVKKEIGGAEGVLV
TAVSPKAFEQAQGMVQRGGTVSLNGLPPGDFPLPIFDTVLNGITVRGSIVGTRLDLQEAL
DFAGAGKVKATIKTDKLENINEIFAKMHHGEIEGRIVIDYQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaccatgaaagccgccgttgtccggcaattcggcaagcctctggtaatggaa
gaggtcgcagtcccctcggtcgggccgggccagattctcgtcaagatggctgcaagcggc
gtctgccacaccgacctgcatgcggcggaaggtgactggccgatcaaacccgagccgcct
ttcattccgggccatgagggcgtgggacacgtcgtcgccgtgggcgccggcgtcagccat
gtcaaggaaggcgaccgcgtcggggttccgtggctctacaccgcctgcggctgctgcaag
cattgcctcggcgggtgggagacgctgtgcgaagcgcagcaaaacaccggctattcggtc
aatggcagttttgcggaatatgttctggctgatccgaactatgtcgggcacctgcctgac
aatgtcagcttcaccgagattgcgccgatcctttgcgcaggcgttacggtctacaagggc
ctgaaagtgacggacaccaaacccggcgactgggtcgtgatttcgggcattggcgggctt
ggacatctggccgtgcaatatgcaaaggcaatgggcctgaatgtgcttgccgtggatatc
gacgacgcgaaactcgacctggcgaaacgacttggcgcaagtctggcggtcaatgcccgc
aatgccgatccggtggccttcgtgaaaaaggaaatcggcggcgcggaaggagttctggtc
accgccgtttcgcccaaggccttcgaacaggcgcagggcatggtccagcgcggcggaacc
gtatcgctcaatggcctgccgcccggcgatttcccgcttcccatcttcgacaccgtgctg
aacggtatcacggttcgcggatcgatcgtcggaacccggcttgacctgcaggaggcgctg
gacttcgccggcgcgggaaaggtcaaggcgacgatcaagaccgacaagctcgagaacatc
aacgagatcttcgccaagatgcatcacggcgaaatcgaaggccgcatcgtcatcgactac
cagtga

DBGET integrated database retrieval system