KEGG   Martelella mediterranea: Mame_01144Help
Entry
Mame_01144        CDS       T04757                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mmed  Martelella mediterranea
Pathway
mmed00240  Pyrimidine metabolism
mmed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mame_01144 (tdk)
Enzymes [BR:mmed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Mame_01144 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 DUF2075 ResIII
Motif
Other DBs
NCBI-ProteinID: AQZ50515
UniProt: A0A1U9YYJ4
LinkDB All DBs
Position
1241373..1241954
Genome map
AA seq 193 aa AA seqDB search
MAKLHFYYATMNAGKSTLLLQAAYNYRERGMHAVILLAELDDRGGKGVVSSRIGLKAEAV
TFGQDTDLFECAGALDQERKIDCLFVDEAHFATAEHAWQLARVVDELKIPVMAYGLRSDF
MGRLFPASAELFVLADEIREVRTICHCGRKATMVVRLDQAGNALLEGPQIEVGGNDRYVS
YCRLHWKEKTGRR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacttcacttttactatgccacgatgaacgccggcaaatcgaccttgctgctt
caggccgcctataattaccgcgagcgcggcatgcacgccgttatcctgctggcagaactc
gatgatcgcggcggcaagggcgtggtttcctcgcggatcgggctcaaggccgaggcggtc
acgttcggccaggacaccgacctgttcgaatgcgcgggcgcgctcgaccaggagcgcaag
atcgattgcctgttcgtcgacgaggcccatttcgccaccgccgagcatgcctggcaattg
gcgcgggtcgtcgatgaactcaagattcccgtgatggcctatggcctcagatccgatttc
atgggccggctgtttccggcatcggccgaactgttcgtgctcgcggatgaaatcagggag
gtgcggaccatctgccattgcggtcgcaaggccaccatggtggtgcgtctggatcaggcc
ggcaacgcgctgctcgaaggcccccagatcgaggtcggcggcaatgaccgctatgtctcc
tattgccgcctccactggaaggaaaagaccggccgccgatag

DBGET integrated database retrieval system