KEGG   Martelella mediterranea: Mame_02049Help
Entry
Mame_02049        CDS       T04757                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mmed  Martelella mediterranea
Pathway
mmed00250  Alanine, aspartate and glutamate metabolism
mmed00410  beta-Alanine metabolism
mmed00430  Taurine and hypotaurine metabolism
mmed00650  Butanoate metabolism
mmed01100  Metabolic pathways
mmed01110  Biosynthesis of secondary metabolites
mmed01120  Microbial metabolism in diverse environments
mmed02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mame_02049 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mame_02049 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mame_02049 (gadB)
   00430 Taurine and hypotaurine metabolism
    Mame_02049 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mame_02049 (gadB)
Enzymes [BR:mmed01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Mame_02049 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AQZ51387
UniProt: A0A1U9Z114
LinkDB All DBs
Position
2206191..2207585
Genome map
AA seq 464 aa AA seqDB search
MADKSAEDDLFDPNDETYGSADFLTVLPKAEFPQKTRAPRSVYAAVKDELMMDGNARQNL
ATFCQTWEEPEVHQLMDDCIDKNMVDKDEYPQTAEIEARCVSMLADLWNAPKGPATGAST
TGSSEAAMLGGLAMKRRWEARRKAEGKPTDKPNLITGPVQICWHKFTRYWDIEHREIPME
NGRLLMTPEEVLKLCDENTIGVVPTLGVTFTGEYEPVKAIADALDDLQARTGLDIPIHVD
GASGGFLAPFCAPELEWDFRIPRVKSINASGHKFGLAPLGVGWVVWREEQDLPEEMIFWV
NYLGGNMRDITLNFSRPGGQVVCQYYNFLRLGRDGYRKVHEACYRSAAYLASELEKTGLV
DIVFDGDMKRGIPAVSWKLKEGVKTEYTLFDLADRLRSRGWQVPAYTLPANCEDQAVQRI
LVRNGVSIDLCSLLIRDIKASVDYFKSHPITRSVSEEEASGFHH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacaaatccgccgaagacgacctgttcgatccgaatgacgaaacctacggctct
gcagatttcctgaccgttctgcccaaggcggaattcccgcagaaaacccgcgcgccgcgt
tccgtctatgccgcggtcaaggacgagttgatgatggacggcaatgcccgccagaacctc
gccaccttctgccagacctgggaagagcccgaagtccaccagttgatggacgactgcatc
gacaagaacatggtcgacaaggacgaatatccgcagaccgccgagatcgaggcgcgctgc
gtgagcatgctcgccgacctgtggaacgcgcccaagggaccagcgaccggggcttcgacg
accggttcgtcggaagccgcgatgctgggcgggctggccatgaagcggcgctgggaagcg
cgacgcaaggcagagggcaaacccaccgacaagcccaatctgatcaccgggccggtgcag
atctgctggcacaagttcacgcgctactgggatatcgagcaccgcgaaattccgatggaa
aacgggcggctgctgatgacgcccgaggaggttctgaagctctgcgacgagaacacgatc
ggcgttgtgccgaccctcggcgtcacctttaccggcgaatacgagcccgtgaaggccatc
gctgacgcgctcgatgacctgcaggcgcgcaccgggctggatatcccgattcatgtcgat
ggcgccagcggcggctttctcgcgccgttctgcgcgccggagcttgaatgggatttccgg
attccgcgggtgaaatcgatcaatgcctccggccacaagttcggccttgcgccgcttggc
gtgggctgggtcgtgtggcgcgaggaacaggacctgcccgaggagatgatcttctgggtc
aactatctcggcggcaatatgcgcgacatcacgctcaatttctcacgtccgggcggtcag
gtcgtctgccagtactataatttcctgcgcctcggccgtgacggttaccgcaaggtgcat
gaggcctgctatcgcagcgctgcctatctggcaagcgaactggaaaagaccgggcttgtg
gatatcgtgttcgacggcgacatgaagcgcggcattccggcggtgtcatggaagctcaag
gaaggggtgaagaccgaatacacgctgttcgaccttgccgacaggctgcgttcgcgcggc
tggcaggtgccggcctacacgcttcccgccaattgcgaggatcaggcggtgcagcgcatt
ctggtgcgcaacggcgtcagcatcgatctctgctcgctgctgatccgcgatatcaaagcc
tcggtggactatttcaaatcccatccgatcaccaggtcggtctccgaggaagaagcctcc
ggcttccatcactga

DBGET integrated database retrieval system