KEGG   Martelella mediterranea: Mame_02085Help
Entry
Mame_02085        CDS       T04757                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mmed  Martelella mediterranea
Pathway
mmed00020  Citrate cycle (TCA cycle)
mmed00190  Oxidative phosphorylation
mmed00650  Butanoate metabolism
mmed01100  Metabolic pathways
mmed01110  Biosynthesis of secondary metabolites
mmed01120  Microbial metabolism in diverse environments
mmed01130  Biosynthesis of antibiotics
mmed01200  Carbon metabolism
Module
mmed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmed_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mame_02085 (sdhA)
   00650 Butanoate metabolism
    Mame_02085 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mame_02085 (sdhA)
Enzymes [BR:mmed01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Mame_02085 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Mame_02085 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AQZ51423
UniProt: A0A1U9Z160
LinkDB All DBs
Position
2242429..2244270
Genome map
AA seq 613 aa AA seqDB search
MANPSSPAANGKAYEYVDHAYDVIVVGAGGSGLRATLGMAEQGFKTACITKVFPTRSHTV
AAQGGIAASLQNMTPDCWQWHLYDTVKGSDWLGDVDAMQYLAMEAPQAVYELEHYGVPFS
RNEEGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFFIEYFA
IDLIMSDDGTCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRTYFSATSAHTCTGDGAGMI
ARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASR
DVVSRCMTMEIREGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPI
PVLPTVHYNMGGIPTNYFGEVLNADGDNPERLAPGLMAVGEAGCASVHGANRLGSNSLID
LVVFGRAAAIRAGQVIDRESPIPALNTAACDRIMERFDKTRHASGSQPTAVLRDKMQRAM
QEEAAVFRTQETLEEGCRRISEIWKELPDVKVTDRSMIWNSDLVETLELQNLMACAITTV
YGAEARKESRGAHAREDYADGPFSGRDDENWRKHTLAWVNEAGDVKLDYRPVHTDLIADG
IDIKKIAPKARVY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccttcttcccccgccgccaacggcaaggcctatgaatatgtcgaccacgcc
tatgacgtgatcgtggtcggcgccggcggttccggcctgcgcgccacgctcggcatggcc
gagcagggcttcaagaccgcctgcatcaccaaggttttcccgacgcgctcgcataccgta
gccgcccagggcggcatcgccgcctcgctgcagaacatgacgcccgattgctggcaatgg
catctctacgacaccgtcaagggttccgactggctcggcgatgtcgacgccatgcagtat
ctcgccatggaagcgccgcaggcggtctatgagctcgagcattacggcgtgccgttctcc
cgtaacgaagagggcaagatttatcagcgccccttcggcggccacatgcagaattacggc
gaaggcccgccggtgcagcgcacctgtgctgccgccgaccgtaccggccacgccatcctg
cacacgctttacggccagtcgctgaagaacaacgccgagttcttcatcgaatatttcgcg
atcgacctgatcatgagcgatgacgggacctgcaccggggtcgtcgcctggaaccttgat
gacggcacgatccaccgcttctccgccaagatggtggtgctggcgaccggcggctatggc
cgcacctatttctcggcgacctccgcgcatacctgcaccggcgatggcgccggcatgatc
gcgcgcgccggcctgccgttgcaggacatggaattcgtgcagttccacccgaccggcatc
tatggcgcgggctgcctgattaccgagggcgcgcgcggcgagggcggttatctggtcaac
tccgagggcgagcgcttcatggagcgctatgcgccgtcggccaaggatctggcctcacgc
gacgttgtctcgcgctgcatgacgatggaaatccgcgaaggccgtggcgttggcaagaac
aaggaccacatcttcctgcatctcgaccatctcgatccggctgtgctgcatgagcgactt
ccgggcatttccgagagcgccaagatcttcgccggcgtcgatgtcacccgcgagccgatc
ccggttctgccgacggtccactacaatatgggcggcattccgacgaactatttcggcgag
gtgctgaacgccgatggcgacaatcccgagcgtctcgcgcccggcctgatggccgtcggc
gaggccggttgcgcctcggtgcacggcgccaaccgtctcggctccaactcgctgatcgat
ctcgtggtcttcggccgcgccgccgcgatccgcgccggacaggtgatcgaccgggaaagc
ccgatcccggcgctgaacacggccgcctgcgaccggatcatggagcgcttcgacaagacc
cgccacgcctccggctcgcagccgacggccgtgctgcgcgacaagatgcagcgcgccatg
caggaagaggcggccgtgttccgcacccaggaaacgctggaggaaggctgccgccggatt
tcggaaatctggaaggaactgccggacgtcaaggtcaccgaccgctcgatgatctggaac
tcggatctggtcgagacgctggaactgcagaacctgatggcctgcgcgatcaccacagtc
tacggcgccgaggcccgcaaggaaagccgtggcgcgcacgcccgcgaggactatgccgac
ggcccgttctccggccgcgacgacgagaactggcgcaagcacacgctcgcctgggtgaac
gaggccggcgacgtcaagctcgactaccgcccggtccataccgacctcatcgccgacggc
atcgacatcaagaagatcgcgccgaaggcgcgggtgtattga

DBGET integrated database retrieval system