KEGG   Martelella mediterranea: Mame_02088Help
Entry
Mame_02088        CDS       T04757                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mmed  Martelella mediterranea
Pathway
mmed00020  Citrate cycle (TCA cycle)
mmed00190  Oxidative phosphorylation
mmed00650  Butanoate metabolism
mmed01100  Metabolic pathways
mmed01110  Biosynthesis of secondary metabolites
mmed01120  Microbial metabolism in diverse environments
mmed01130  Biosynthesis of antibiotics
mmed01200  Carbon metabolism
Module
mmed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmed_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mame_02088 (sdhB)
   00650 Butanoate metabolism
    Mame_02088 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mame_02088 (sdhB)
Enzymes [BR:mmed01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Mame_02088 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Mame_02088 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: AQZ51426
UniProt: A0A1U9Z152
LinkDB All DBs
Position
2244983..2245762
Genome map
AA seq 259 aa AA seqDB search
MVEFTLPKNSKIKTGKTWPKPEGASNLREFKIYRWNPDTGENPSIDTYFIDLDDCGPMVL
DALLYIKNNIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGMDDIKGAVKIYPLPHMP
VVKDLVPDLNNFYAQHRSIEPWLKTVSPPPAKEWKQSHEDRVKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEATGERLDNLEDPFRLYRCHTIMNCTQACPKG
LNPAKAIAGIKKMMVERSV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattcacgcttcccaagaactcgaagatcaagaccggcaagacctggccgaag
ccggaaggcgcttccaatcttcgcgagttcaagatctaccgctggaacccggataccggc
gagaacccgtcgatcgacacctatttcatcgatctcgatgattgcgggccgatggttctc
gatgcgctgttgtacatcaagaacaatatcgatccgacgctgacgctgcgccgctcctgt
cgcgaaggcatttgcggttcgtgcgcgatgaatatcgatggcaccaacacgctcgcctgc
accaagggcatggacgacatcaagggcgcggtgaagatctacccgctgccgcatatgccg
gtggtcaaggacctcgtgccggacctcaacaatttctacgcccagcaccgttcgatcgaa
ccctggctcaagaccgtctcgccgccgccggcgaaggagtggaagcagagccatgaggac
cgcgtgaagctcgacgggctttatgaatgcatcctgtgcgcctgctgctcgacctcctgt
ccgtcctactggtggaacggcgatcgctatctcggtcccgccgtgctgctgcaggcctat
cgctggttgatcgactccagagacgaggcgaccggcgagcggctcgacaatctggaagat
cctttccggctctaccgctgccacaccatcatgaactgcacccaggcctgtccgaagggg
ctgaaccccgccaaggcgatcgccggcatcaagaagatgatggtcgagcgttcggtttga

DBGET integrated database retrieval system