KEGG   Martelella mediterranea: Mame_03315Help
Entry
Mame_03315        CDS       T04757                                 

Gene name
gstB_2
Definition
(GenBank) Glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmed  Martelella mediterranea
Pathway
mmed00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mame_03315 (gstB_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmed02000]
    Mame_03315 (gstB_2)
Enzymes [BR:mmed01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mame_03315 (gstB_2)
Transporters [BR:mmed02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mame_03315 (gstB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AQZ52624
UniProt: A0A1U9Z4N4
LinkDB All DBs
Position
3575231..3575851
Genome map
AA seq 206 aa AA seqDB search
MSRITLYTNPLSRARIARWMLEEVGTEYETRILTYNGTMKEPAYLAINPMGKVPAIVHDG
DVVTECAAICAYLADAFPEAGLAPPPAERASYYRWLFFAAGPLEAAIVNNSFGFVVPAER
ERSVGYGNFEHVMDTLDKWLSENRFVAGDSFSAADVYVGAQVNWGLQFGTFDKRDSFAAY
AERIAARPAFIRASKLDDEAAAAAQT
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaattaccttgtacaccaacccgctgtcgcgcgcgcggatcgcccgctggatg
ctggaggaggtcgggaccgagtacgaaacccgcattttgacctataacggcacgatgaaa
gagccagcctatcttgccatcaacccgatgggcaaggtgccggcgattgtccatgacggc
gatgtggtgacggaatgcgcggcgatctgcgcctatctcgccgacgcctttcccgaggca
gggcttgcgccgccgcccgccgagcgcgcctcctactaccgctggctgttcttcgccgcc
ggcccgctcgaagcagccatcgtcaacaacagtttcggctttgtcgttccggccgaacgg
gaacgctcggtcggctacggcaatttcgagcatgtcatggatacgctcgacaaatggctg
tcggaaaaccggttcgttgccggcgacagcttcagcgccgccgatgtctatgtcggcgcc
caggtcaactggggcctgcagttcggcacgttcgacaagcgcgattcctttgcggcctat
gccgagcgcatcgccgcccgcccggccttcatccgcgccagcaagctggatgacgaggcc
gccgcggcggcccaaacctga

DBGET integrated database retrieval system