KEGG   Martelella mediterranea: Mame_04695Help
Entry
Mame_04695        CDS       T04757                                 

Gene name
cga
Definition
(GenBank) Glucoamylase precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mmed  Martelella mediterranea
Pathway
mmed00500  Starch and sucrose metabolism
mmed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mame_04695 (cga)
Enzymes [BR:mmed01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Mame_04695 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AQZ53987
UniProt: A0A1U9Z8E9
LinkDB All DBs
Position
pMM593:381626..384058
Genome map
AA seq 810 aa AA seqDB search
MSDMIDFATGAPGIGSRWTSSAKSGVGTALSVASPVWFTLSHGILNEIYYPRVDSACTRD
FGFLVTGPDGYFSEEKRDCEQETTPLEDGVPAFSIVNTALDGAYRIRKQIISDPARAVVL
QRISFSALKGRTRDYRVTALLAPHLVNAGASNSAWIGEFEGAPALFASGRSRYLALVSSA
PWRAMSAGFVGTSDGWQQLSRHGRLVDQYQRADDGNVALAGEIDFSGGDGSVVLALGFGQ
TEHEAAAVATRSLKDGFDHALDKFITGWRKWQDGLVPLDRKAEDGINAYRVSTAVLATHR
ASDRPGAAVASLSIPWGYSKGDDDLGGYHLVWPRDLVETAGGFLAAGDAKAALAILDYLR
ELQQPSGRWAQNFWLDGKPYWPGVQMDECAFPILLADMLRCQGHLNGKTIRRFMPMIKSA
AGYILANGPSTGEDRWEEDGGYSPFTLAVEITALLAAADILEAEGETKAAHHLRETADCW
NEQIEKWTFEGDPDLCRSLDIAGYYVRIAAPGATDAAGPAGETPIRNQTPDRSIMASDAV
ISPDALALVRFGLRAADDPHIVDTVKAIDHTLRMELPQGPLWYRYTGDGYGEHEDGRAFD
GIGQGRPWPLLAGERAHYELAAGRTDAAKALLETFEKSANAGGLLPEQSWDGPDMPDREL
YFGRPSGSAMPLVWAHSEHIKLLRSLADGAVFDMPPQGRSRYIEKQTASRIRIWRFDNRL
ATIPAGKKLRIELADAATIHWSADGWSTVKDIKTKPSGLGTHFADLPLKGVEPGHAVVFT
FFWPESGQWENVDFTVRVGEQVDRQLETEF
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatgatcgattttgccacaggcgcgccgggcatcggctccaggtggacgtcg
agcgccaagagcggggttggcaccgcgctttcggtggcttcgccggtctggtttacgctg
agccacggcattctcaacgagatatattatccccgcgtcgacagcgcctgcacccgcgat
ttcggtttcctcgtaaccggcccggatggctatttttccgaggaaaagcgcgattgcgag
caggaaacaacgccgcttgaggatggcgttccggccttttcgatcgtcaacaccgctctt
gatggcgcctaccggatcagaaagcagatcatcagcgatccggcgcgggcggtcgttctc
cagcgcatttcgttcagcgcgctcaagggcaggacccgcgattaccgggtgaccgcgctt
ctggcgccgcatctggtcaatgccggcgcatcgaactccgcctggatcggcgagttcgag
ggcgcgccggcgttgtttgccagcggccgttcccgctatctggcgctggtatcaagcgcg
ccgtggcgcgcaatgtccgccggtttcgtcgggacgtcggatggctggcagcaattgtcc
cggcatggacggctcgttgaccagtaccagcgcgccgatgacggcaatgtggcgctggcc
ggcgagatcgatttttccggcggcgatggttccgtggtgctggcgctcggttttggccag
accgaacacgaagccgccgccgtcgccacgcggagcctgaaggacggcttcgaccacgct
ctggataaattcataaccggctggcggaagtggcaggacggtctggtcccgctcgatcgc
aaggcggaagacgggatcaacgcctatcgcgtctcgacggcggtgctggcgacccaccgg
gcctcggaccggcccggcgccgcggttgccagcctgtcgatcccctggggctattcgaaa
ggcgatgacgatcttggcggctaccatcttgtgtggccccgcgacctggtcgagacggcc
ggcggctttctggccgcgggggatgcgaaagcggcgctggcgatcctcgattatctgcgc
gagctgcagcagccctccggccgctgggcgcagaacttctggctcgacggcaagccctac
tggcctggcgtccagatggacgagtgcgccttcccgatcctgcttgccgacatgttgcgg
tgtcagggccatctgaacggcaagacaatccgccgctttatgccaatgataaagagcgcc
gccggctatatcctcgccaatggtccctccaccggagaagaccgctgggaagaggacggc
ggatacagcccgttcacgctcgcggtcgaaatcacggccctgctggccgctgccgatatt
ctggaagccgagggcgaaacgaaagcggcccatcatctgcgcgagacggccgattgctgg
aacgagcagatcgagaaatggaccttcgagggcgatccggacctctgccggtcattggat
atcgcgggctactacgtccgcattgccgcgcccggggcaacggatgccgccggtccggcg
ggcgaaacgccgatccgcaaccagacgcccgaccgttcgatcatggcgagcgatgccgtg
atcagtccggacgcgctggcgctggtgcgcttcgggctgcgcgcggcggacgatccgcat
atcgtcgataccgtcaaggcgattgaccacacgctgcgtatggaactgccgcaaggcccg
ctctggtaccgctacaccggcgacggttacggcgagcatgaagacggccgggctttcgac
ggcatcggtcaggggcggccctggcccttgctggcaggcgagcgcgcccattacgagctt
gccgccggccggaccgatgcggccaaggccctgctcgaaaccttcgagaaatccgccaat
gccggcgggctgctcccggagcaaagctgggatggccccgatatgccggatcgcgaactt
tatttcggccggccctcgggcagcgcgatgccgctggtctgggcgcattcggagcatatc
aaactgctgcgctcgcttgccgatggcgccgtgttcgacatgccgccgcagggccggagc
cgctatatcgagaagcagacagcgtcaagaatacggatctggcggttcgacaacaggctg
gccacgatcccggccggcaagaagctcaggatcgaactggcggatgcggcaaccatccac
tggagcgccgatggctggtcgaccgtcaaggacatcaagacgaagccatcggggctcggg
acccatttcgcggatctgccattgaagggcgtggaacccggacatgccgtggttttcact
ttcttctggccggaaagcgggcagtgggagaatgtagatttcaccgttcgcgtcggcgaa
caggtcgatcggcaactggaaacggagttttga

DBGET integrated database retrieval system