KEGG   Martelella mediterranea: Mame_04788Help
Entry
Mame_04788        CDS       T04757                                 

Gene name
arnC
Definition
(GenBank) Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
mmed  Martelella mediterranea
Pathway
mmed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmed01003]
    Mame_04788 (arnC)
Enzymes [BR:mmed01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     Mame_04788 (arnC)
Glycosyltransferases [BR:mmed01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   Mame_04788 (arnC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 GtrA Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: AQZ54080
UniProt: A0A1U9Z8W4
LinkDB All DBs
Position
pMM593:complement(484884..486020)
Genome map
AA seq 378 aa AA seqDB search
MEMFLPAARAQPERLHSAPDVSVIIPTFNERENVGKLVSHLIATLHGLNWEVIFVDDDSA
DRTVEVLRDIGHYEPRIRCIRRVGRRGLAGACIEGILSAQGEIVAVMDADLQHDHRLLPD
LVAAIRDGNDLAIATRYSSPRQETALSPFRSAMSRIGTYLAQRLITARTTDPMSGFFATR
RDLVEAMAPRLSNGGFKILFDILSNAEPDVRIAELPYRFATRSAGHSKMDRRVALQFLGL
LFTKATRGLVSLRLVSFFLIGAAGLGLHMALLILVLVAGVNFAAAQAIATLITMVVNFSG
NNLLTYHDQQLRGRSFFRGLLVYVAICGIGAVVNVGIATALFTVAGPWWVAGLAGAFVSG
LWNYLVTQTLVWNRPGAL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggagatgttccttccagccgctcgagcccaacccgaacggcttcactcagctccggac
gtttcggtgatcataccgacattcaacgagcgggagaatgttggcaagctcgtgagccac
ctgatcgccaccctccacggcctgaactgggaggtgatattcgtggatgacgattctgcc
gatcgcaccgtcgaggtgctgcgcgatataggccattatgagccgcggatacgctgcatt
cgccgggtcggccgacgcgggcttgccggtgcttgcatcgagggcatattgtccgcgcag
ggcgagatcgtcgcggtcatggacgccgatcttcagcatgatcaccggctcctgccggat
ctggtcgccgccatacgcgacggaaacgatctcgccatcgccacccgatatagctcgcct
cgccaggaaacggcgctctcgccattcaggagcgccatgtcgaggatcgggacttacctt
gcgcaacgcttgatcacggcgcggacgaccgatcccatgagcggcttcttcgcgacacgc
cgtgatctggtcgaagcgatggcgccgcggctgagcaatggggggttcaagattctcttc
gatatcctttcaaatgcggaaccggatgtccggatagccgaattgccctatcgcttcgcc
acccgttcggccggacacagcaagatggatcgtcgcgtcgcccttcaattcctgggactt
ctcttcaccaaggcaacgagagggctggtctccttgcggttggtatcttttttcctgatc
ggcgccgctggcctgggcctgcacatggcgctgctcatcctggttcttgtcgcgggcgtg
aatttcgcggccgcccaagcgatcgcaaccctgatcaccatggtcgtcaatttctcgggc
aacaacctgttgacctatcacgaccaacaattgcgagggcgcagcttcttccggggattg
ctggtatatgtcgcgatatgcggcattggggctgtggtcaatgtcggtatcgcgacggcg
ctgttcacggtggccggcccctggtgggttgcgggtcttgccggcgccttcgtcagcggc
ctgtggaactatctggtcacccaaaccctcgtctggaaccgcccgggggcgctatga

DBGET integrated database retrieval system