KEGG   Methanococcoides methylutens: MCMEM_0282
Entry
MCMEM_0282        CDS       T03913                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mmet  Methanococcoides methylutens
Pathway
mmet00300  Lysine biosynthesis
mmet01100  Metabolic pathways
mmet01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MCMEM_0282
Enzymes [BR:mmet01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MCMEM_0282
SSDB
Motif
Pfam: NAD_binding_7 2-Hacid_dh_C 3HCDH_N F420_oxidored adh_short NAD_binding_2 AlaDh_PNT_C TrkA_N UDPG_MGDP_dh_N Mur_ligase Shikimate_DH MAAL_N Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: AKB84335
UniProt: A0A0E3WZ19
LinkDB
Position
complement(301613..302392)
AA seq 259 aa
MALLTPEDLEDLLNKLNANNDIIKGATGEDISQICEEAYGTKPGNQKVGIVPITAGNGII
GNFSASLLAITEYFGLEGFITEHPDMTGYYEAVAGGADIILMADDHIFIAHNLSNGKIAT
NHICTGVIYSEIASRYKHADSKDVLVIGLGRVGYAGASHLVKKGFNVYACDPNTEFMNKA
IEELGVNAFDIEKPRKFSMVFEATPNANTISEGMIAERCLVSTPGIPCALPDDLVEKYDI
DLVMEPLVIGVAAMLYSIF
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcattattaacacctgaagatctggaagacctgctgaacaagcttaacgcgaacaat
gatattataaaaggagctaccggagaggatatctcacagatatgtgaggaagcctatggc
acaaaacccggaaaccagaaagtgggaattgtacccatcactgctggcaacggtatcatt
ggtaacttctcagcatccctgcttgcaataaccgaatatttcggacttgaaggttttatc
accgaacatccggacatgacaggatattatgaggcagttgcaggtggtgcggacatcata
ctgatggcagacgatcatatctttattgcacacaacttaagcaatggtaagatcgcaaca
aaccatatatgcaccggcgtgatctactcagagatagcttcaagatacaagcacgctgat
tcaaaggacgttctggtcatcggtcttggacgtgtgggatacgcaggcgcatcacacctt
gtgaaaaagggattcaatgtgtatgcatgcgacccgaacaccgagttcatgaacaaagct
atcgaagagctgggcgtcaacgcctttgacattgaaaaaccaaggaagttctccatggta
tttgaggcaaccccaaatgcaaacacgatatcagaaggaatgatcgcagaaagatgtctg
gtatcaaccccgggcatcccgtgcgccctgccggacgaccttgtggagaaatacgatatt
gaccttgtcatggaaccactggtaattggtgttgcagcaatgctctattcaattttttaa

DBGET integrated database retrieval system