KEGG   Methanococcoides methylutens: MCMEM_0916Help
Entry
MCMEM_0916        CDS       T03913                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mmet  Methanococcoides methylutens
Pathway
mmet00500  Starch and sucrose metabolism
mmet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MCMEM_0916
Enzymes [BR:mmet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MCMEM_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AKB84969
UniProt: A0A0E3WZL7
LinkDB All DBs
Position
956732..957916
Genome map
AA seq 394 aa AA seqDB search
MYFQLHQPYRLKWFWPDDSKGFERYFDVAINRNIFEKVASKCYVPATTLLAELVEQYGGD
FKFSVSITGTLLSQCEKWNPDVLDIFQRLADSKCVEFLDETNYHSLAGLFDSKDEFREEV
KTHHDITSELLGVKPQVFRNTELLFNNSVAEAVSSMGYKAILTEGVDQLLQSRSPNHVYK
AKDCDIAVLMRNYKMSDDIGYRFSARWWEEYPLTADKWACWASREQGDCLNIFMDYETFG
EHQWADTGIFDFMRALPDEVLSKDIEFNTPSEVVDRYGPVGEIDVGDFNTISWADMERDT
SAWLGNDMQRRCFEEAKRLGPYVKRTKDPELINIWKHLLTSDHYYYMSTKWLGDGDVHSY
FSIHNSPYDAAINFMAVFLDFKSCVFRKLAEIGE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtacttccagctacatcagccatatcgcctgaagtggttctggcctgatgactcgaaa
ggatttgaaaggtatttcgatgttgcaataaacaggaacatctttgagaaggtagccagc
aaatgctacgttccggcaacaaccctcctggcagagctcgttgaacagtatgggggcgac
ttcaagttcagtgtctcaataaccggcactctcctgagtcagtgtgagaaatggaaccct
gatgtactggacatcttccagcggcttgctgactcaaaatgtgtggaattcctcgatgag
accaattaccattcccttgcaggtctttttgatagcaaggacgagttcagggaagaggta
aagactcatcatgatatcacttcagaactgcttggtgtaaagccacaggtcttcaggaac
acggaactccttttcaataatagtgtagcagaggcagtttcatccatgggttataaggct
atacttacagagggtgttgaccagcttctgcaatcacgctcaccaaatcatgtctataag
gcaaaggattgcgatatagctgtccttatgaggaactacaaaatgagtgatgacattggt
tatcgtttctcggccagatggtgggaagagtatcccctgaccgctgataagtgggcctgc
tgggcatccagagagcaaggtgattgcctgaacatcttcatggattacgagaccttcggt
gaacaccagtgggcagatacgggtatctttgatttcatgagggccctgccggatgaggtt
cttagcaaggacattgagttcaacactccatccgaagtagttgacagatatggaccggta
ggcgagatcgatgttggtgactttaacacgatctcctgggcagatatggagcgagataca
agtgcatggcttggcaacgatatgcagcgcaggtgcttcgaagaggcaaagaggcttgga
ccttatgtgaagcgaacaaaagacccggagcttatcaacatatggaaacatctcctcaca
tccgatcactattactatatgagtacaaaatggctgggtgacggtgatgttcattcatat
ttcagcatccataattcaccctacgatgcagcaatcaatttcatggcagtgttcctggat
ttcaagtcatgtgttttcaggaagctggctgaaataggtgagtaa

DBGET integrated database retrieval system