KEGG   Methanococcoides methylutens: MCMEM_1588Help
Entry
MCMEM_1588        CDS       T03913                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mmet  Methanococcoides methylutens
Pathway
mmet03030  DNA replication
mmet03410  Base excision repair
mmet03420  Nucleotide excision repair
mmet03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmet00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MCMEM_1588
   03410 Base excision repair
    MCMEM_1588
   03420 Nucleotide excision repair
    MCMEM_1588
   03430 Mismatch repair
    MCMEM_1588
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmet03032]
    MCMEM_1588
   03400 DNA repair and recombination proteins [BR:mmet03400]
    MCMEM_1588
Enzymes [BR:mmet01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MCMEM_1588
    6.5.1.6  DNA ligase (ATP or NAD+)
     MCMEM_1588
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MCMEM_1588
DNA replication proteins [BR:mmet03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MCMEM_1588
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MCMEM_1588
DNA repair and recombination proteins [BR:mmet03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MCMEM_1588
   NER (nucleotide excision repair)
    Other NER factors
     MCMEM_1588
   MMR (mismatch exicision repair)
    Other MMR factors
     MCMEM_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AKB85641
UniProt: A0A0E3SRM4
LinkDB All DBs
Position
complement(1728688..1730373)
Genome map
AA seq 561 aa AA seqDB search
MTDFKDFADVCKRIEHTSGSLDMTDIVSEMFHSVSAEELPVVAHFVMGDVFPAWSTEQLG
VGPSLLYTALSRSSGLPLKEIETLVRNTGDIGETAIAALKKETRNQATFSAFMDETPSLS
IMEVFERFNNISGTTGKGSQTTKIKNLQYLFNSATPEEARYLARLAIEDLRIGVGEGIVR
DAIAKAFGVPAGDVERGFMLTNDLGLVAVAAKEGGVEAVSQLGMELNRPIKMMLAQVTPT
IETAINDLGVVAVEWKFDGARVQIHKDGDNINIFSRRLENVTGSLPDIVQAVKDHVKADT
AILEGEAVAVDEHGNPRAFQDILKRFRRKYDVETTVREIPLTLNLFDLLYLNDEVLIDMP
LTDRRDALVDCVENTNGIRVDEQVLTKDPEKVNEIYSAALAAGHEGVMIKNPEAPYSPGK
RGKNWLKKKPIMETLDLVVVGAEWGYGRRANLIGSYALACFDPDTGDFLPIGKVATGFSD
EQLAELTDLLSDLIVVESGRDIELKPEVVFEVAFEEIQKSTNYESGYALRFPRLVNIRDD
KSPEEAETLERIESIYLSQRS
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaaagattttgctgacgtgtgcaaaagaatagaacatacctcaggttca
ctggatatgaccgacatcgtctcagagatgttccactcagtatccgctgaagagctccct
gttgttgcacatttcgtcatgggtgacgtattccctgcatggagcactgaacaactggga
gtcggtccaagtcttctttatacagctctttccaggtcgtcaggtcttccgctcaaggag
atagagacccttgtaaggaacaccggcgacatcggtgaaactgctattgcagcactgaaa
aaggaaacccggaaccaggctacattctctgcttttatggatgagactccgtctctttcc
atcatggaagtatttgagaggttcaacaacatctcagggacgaccggtaaaggttcacag
acgaccaagatcaagaaccttcaatatcttttcaattcagcaactcctgaagaggcccgc
tatcttgcaaggctggcaatagaggaccttcgtatcggtgttggtgaaggtatcgtaagg
gatgccattgccaaagctttcggtgtccctgccggggatgtcgaacgcggtttcatgctt
accaatgatctcggccttgttgcagttgctgcaaaagagggcggtgtggaagctgtttca
caacttggtatggaactaaaccgtcctatcaagatgatgctggctcaggttaccccgaca
attgaaactgctatcaatgatcttggtgttgtggcggttgaatggaagttcgatggtgcc
agggtccagatacataaggacggggataatatcaacatcttctcaaggcgccttgagaac
gtgaccggttcacttcctgatatcgtccaggccgtaaaagatcatgtaaaggcagatact
gcaattctcgagggggaggcagttgcagtggatgagcacggtaacccgagagctttccag
gacatccttaagcgtttcaggagaaagtatgatgtggagacaacggtccgtgagatcccg
ctgacactgaatctttttgatcttctctatcttaacgatgaggtcctgatcgacatgcca
cttaccgacaggagagatgccctggtagattgtgtggaaaataccaatggtatcagggtc
gatgaacaggtgcttaccaaagatccggaaaaagtgaacgagatctactctgcagcactg
gctgcagggcacgaaggtgtaatgatcaagaatccggaggctccatactctcctggaaag
aggggtaagaactggctcaagaagaagcctatcatggagaccctagatcttgtagtggtc
ggtgctgaatggggttatggaaggcgtgcaaacctgatcggctcttacgcgctggcatgc
tttgacccggataccggcgatttccttcctataggaaaagtggccactggtttttcagat
gagcagcttgcagaacttactgacctcctgtccgacctgatcgtcgtagaatccggaaga
gatatcgaattgaaacccgaagttgtctttgaggttgctttcgaggagatccagaaaagt
accaattacgaatccggttacgcactaaggttcccaaggcttgtgaatatcagggacgac
aagtctcctgaagaagccgagacccttgagcgtattgagagcatttatctctcgcagaga
agttga

DBGET integrated database retrieval system