KEGG   Methanothermobacter marburgensis: MTBMA_c01660Help
Entry
MTBMA_c01660      CDS       T01297                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg03030  DNA replication
mmg03410  Base excision repair
mmg03420  Nucleotide excision repair
mmg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MTBMA_c01660 (lig)
   03410 Base excision repair
    MTBMA_c01660 (lig)
   03420 Nucleotide excision repair
    MTBMA_c01660 (lig)
   03430 Mismatch repair
    MTBMA_c01660 (lig)
Enzymes [BR:mmg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MTBMA_c01660 (lig)
    6.5.1.6  DNA ligase (ATP or NAD+)
     MTBMA_c01660 (lig)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MTBMA_c01660 (lig)
DNA replication proteins [BR:mmg03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MTBMA_c01660 (lig)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MTBMA_c01660 (lig)
DNA repair and recombination proteins [BR:mmg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MTBMA_c01660 (lig)
   NER (nucleotide excision repair)
    Other NER factors
     MTBMA_c01660 (lig)
   MMR (mismatch exicision repair)
    Other MMR factors
     MTBMA_c01660 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADL57775
UniProt: D9PU77
LinkDB All DBs
Position
171439..173094
Genome map
AA seq 551 aa AA seqDB search
MLYIELAEVYRKLESTTKRLEKTDILAELFSSVERDLLPVVTLLMLGRVFPIWSEEELGV
GIKLLMRAISTVVGVSVDEIEDAMREEGDIGLASEKLFSKKTQTTFFSQPLTVEFVYDKL
RSLAFVTGERAQSRKIGILVEVLSQAKPLEARYITRTVLEELRVGVAEGIIRDAISRASG
ADPALVERAHMLTNDLGMVAAVAMEEGNPGLEKLNLEPGRPVKPMLAQLAESIESAIEDL
GRAFCETKYDGIRVQIHRKGDEISIFTRRLENITAAVPDILEGVERALPDEDYIVEGEII
VTIEGRPASFQYILQRVRRKYDIERLRRKVPLSLFLFDVLYYERPLIDEPLRERRRVLES
IISEIPGEIEASRMVDVGPDNVDEALWLFRESIREGHEGIMIKDTESPYIPGIRGKKMLK
FKAEPETLDLIVVGGTYGRGKRAHLIGSYLLAARDDDTGELVTVAHVATGLDDETLQELS
ERMENLAIERKGRKLSVRPEIILEVAYSEIVRSPEYESGYSLRFPVVKRIRDDLSPEDID
TVSRIESMFRA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
ttgctctatattgaacttgcagaggtctacagaaaactggaatcaacaacaaagcgcctc
gaaaagacagatatccttgcagagctcttcagcagcgttgaaagggaccttttacctgtg
gtgaccctcctcatgcttggaagggtttttccaatctggagtgaggaggaactaggggtt
ggtataaaacttctcatgagggcgatatcaactgtcgtgggcgtttcggttgatgaaata
gaagatgcaatgagggaggagggagatatcgggcttgcgagcgagaaactcttctcaaag
aaaacccaaactaccttcttttcgcaaccactcacggttgaatttgtttatgataaactg
cgctcactggcatttgtaacaggtgaaagggcccagtcaaggaagataggtatacttgtt
gaggtcctatcccaggcaaagccacttgaggcacgttacatcaccaggacggtccttgaa
gaactccgggtgggggttgcagagggaattataagggatgccatctccagggcctcagga
gccgaccctgcgcttgttgagagggcccacatgctcaccaatgacctgggtatggtggct
gccgttgcaatggaggagggtaatccgggccttgaaaagctgaaccttgaacctggaagg
cctgtaaagccaatgcttgcacagcttgctgagagcatagaatctgcgatagaggatctt
ggaagggcattctgtgagacaaagtatgatggtataagggtccagatacaccgaaaaggg
gacgagatatctattttcacacggagacttgaaaacataaccgcggcggtccctgacatc
cttgagggcgttgaaagggcgctcccggatgaagactacatagttgagggtgagatcatc
gttacaattgagggcagacccgcttccttccagtacatactccagagggtcaggagaaag
tatgatatagaacgattgaggaggaaggttcccctttccctcttcctctttgacgtcctc
tattatgaaagaccccttatcgacgaaccacttagggagaggaggagggttcttgagtca
atcatctctgagattccaggggagattgaggcgagccggatggttgatgtgggccctgat
aacgttgatgaagccctgtggctcttcagggaatcaataagggagggtcatgagggtata
atgataaaggacacagagtcaccatatataccgggtataaggggtaaaaagatgcttaaa
ttcaaggccgaacccgaaacactggacctcattgtggttggtggcacctatggccgcgga
aaaagggcccaccttattggttcataccttctggctgcaagggatgatgatacaggggag
cttgtgacggtggctcatgttgcaacgggactggatgatgaaaccctccaggaactctca
gagaggatggagaaccttgccattgagcggaagggcaggaaactgagtgtcaggcctgag
ataatacttgaggtggcctacagtgaaatagtccggagccctgagtatgagagcggctac
tcccttcgttttcctgttgtaaaacgcataagggacgatctaagccctgaggacattgat
acggtttcccgtatagagtcaatgttcagggcttga

DBGET integrated database retrieval system