KEGG   Methanothermobacter marburgensis: MTBMA_c13290Help
Entry
MTBMA_c13290      CDS       T01297                                 

Gene name
ppcA
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00620  Pyruvate metabolism
mmg00680  Methane metabolism
mmg00720  Carbon fixation pathways in prokaryotes
mmg01100  Metabolic pathways
mmg01120  Microbial metabolism in diverse environments
mmg01200  Carbon metabolism
Module
mmg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTBMA_c13290 (ppcA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTBMA_c13290 (ppcA)
   00680 Methane metabolism
    MTBMA_c13290 (ppcA)
Enzymes [BR:mmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MTBMA_c13290 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADL58917
UniProt: D9PXG9
LinkDB All DBs
Position
1223495..1224946
Genome map
AA seq 483 aa AA seqDB search
MKVPRCMSTQHPDNVNPPFFAEEPELGGEDEIREAYYVFSHLGCDEQMWDCEGKEVDNYV
VKKLLTKYQAFFRDHVLGEDLRLTLRVPNPTVERAEAKILLETLESIPRSYDTASLFYGM
DAAPVFEVILPMTSSSSCLNRIHSYYLDFVKGKERLQLADGVTVKEWIGEFRPDEINVIP
LFEDHEGMLNAAKITGEYLDGKDIPEQRVFLARSDPAMNYGMISATLLNRIALSDFRDLE
EESGVKLYPIIGMGSAPFRGNLRPDNVEDVTGEYRGAYTFTVQSSFKYDHEPSDVIRGIK
ELRSVKPGRAAEIEREGVLEILSAYCREYRRQVMDLVDIINRVARYVPGRRKRKLHIGLF
GYSRSMGNVSLPRAITFTAALYSLGVPPELLGFNALSSGDLEFIEEVYPGLGRDLHDAAR
YANPESPFLSPEVKSSFEEYLEPEYDEGHMKTTEEIIRALRINRTANLQELILEAASQRK
FLG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttccaagatgcatgagtacacagcatccagacaacgttaacccgccgttcttt
gcagaagaacctgaactgggtggtgaagacgagataagggaggcatactacgtcttctca
cacctgggatgtgacgaacagatgtgggactgcgagggcaaggaagtggacaactacgtt
gtaaagaaactcctcacaaagtaccaggccttcttcagggaccatgtcctgggtgaggat
ctgaggctcaccctcagggtgcccaaccccacagttgagagggccgaggcaaagatactc
cttgagacccttgagagcatacccagatcctatgacaccgcaagcctcttctacgggatg
gacgcagccccggtcttcgaggtcatcctccccatgacctcatcaagcagctgcctcaac
cggatccacagctactacctggactttgtgaagggtaaggagaggctgcagctcgcagat
ggtgtgaccgtcaaggagtggataggtgaattccggcccgacgagatcaacgttatcccc
ctcttcgaggaccatgaggggatgctgaacgccgccaagatcacaggcgagtaccttgat
ggtaaggatatcccggagcagagggtcttccttgcaaggtcagaccctgccatgaactac
ggtatgatatcagccacactcctcaacaggatagccctctcagacttccgggaccttgag
gaagagtcaggagttaaactctacccaataataggtatgggctcagctcccttcaggggt
aacctccgccccgataatgtggaggacgttaccggggagtaccgtggcgcctacaccttc
actgtccagtcatccttcaagtacgaccatgaaccatcagatgtcatcaggggcataaag
gaactaaggtctgttaaacctggcagggcagctgaaatcgagcgtgaaggtgtcctggag
atactttcagcctactgccgggagtacaggaggcaggtcatggacctcgtggacatcata
aacagggttgcgaggtacgtgcccggcaggaggaagaggaagctccacatcggactcttc
ggatactcaaggagcatgggaaacgtttcactcccaagggcaataaccttcacagcggcc
ctctactcgctgggggttcccccggagctgctcgggttcaacgcgctatcatcaggtgac
cttgaattcattgaggaggtctacccgggtcttggaagggacctccatgacgctgcaagg
tacgccaaccctgaatcaccattcctcagccctgaggttaaatcctcctttgaggagtac
cttgaacctgagtatgatgaggggcacatgaagaccacagaggagatcataagggccctc
agaatcaaccggacagccaacctccaggagctcatccttgaggctgcaagccagaggaag
ttcctcggctga

DBGET integrated database retrieval system