KEGG   Methanohalophilus mahii: Mmah_0280
Entry
Mmah_0280         CDS       T01211                                 

Definition
(GenBank) hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00300  Lysine biosynthesis
mmh01100  Metabolic pathways
mmh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mmah_0280
Enzymes [BR:mmh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Mmah_0280
SSDB
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 NAD_binding_7 3HCDH_N TrkA_N adh_short F420_oxidored ApbA AlaDh_PNT_C
Other DBs
NCBI-ProteinID: ADE35812
UniProt: D5E9G1
LinkDB
Position
complement(300508..301287)
AA seq 259 aa
MALLTPQDLEGLTKQLEYNNNTIKKATGMDIADICKQIYSTTLDGEKVGIVPITSGNGII
SNFSSSLLTITEYFGLDGDITEHPDVTGYYEAVSSDADIILMADDHIFIAHNMRNGKIAT
NHVCTGVVYAEIASRYKYADSKDILVIGLGRVGYAGAQHLVKKDFDVYAYDPNRETLEKA
RKELGIIPYDPEEKHKFSMVLEATPNPNTISEGMVAERCLVSTPGIPCGLPEDIGKKNEI
DLVMEPLMIGVASMIYAVM
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcactacttacaccacaagatctggaaggacttacaaaacagcttgagtacaataac
aatactatcaaaaaagcaaccggaatggacattgctgacatatgcaaacaaatatacagc
accactcttgacggagaaaaagtagggattgtgcctataacttccggcaatgggatcatt
agcaatttttcgtcatccctgcttacgataaccgaatatttcggtcttgatggtgatata
accgagcatcccgatgttaccgggtactatgaagctgtttccagtgatgccgatataata
ttgatggcagatgaccacatttttattgcgcataatatgagaaacggcaaaattgcaacc
aatcatgtatgcaccggtgtggtttacgcggagattgcctcccgttacaaatatgccgat
tcgaaggatatacttgtaatcggcctgggaagagtgggttatgcaggggcacaacatctt
gtaaaaaaggatttcgatgtgtatgcctatgacccaaatcgggaaactctggaaaaagcg
cgcaaggaactgggcatcataccctatgaccccgaagaaaaacacaagttttccatggtc
ctggaggctacaccaaaccccaacacgatctcagaaggcatggtggcagaaagatgcctc
gtatccacacctggaatcccctgtggtttacctgaagacatcgggaaaaagaacgaaatc
gatctggtaatggaacctctgatgattggcgtggcttcaatgatttatgctgttatgtaa

DBGET integrated database retrieval system