KEGG   Methanohalophilus mahii: Mmah_0767Help
Entry
Mmah_0767         CDS       T01211                                 

Definition
(GenBank) glycoside hydrolase family 57
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00500  Starch and sucrose metabolism
mmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmah_0767
Enzymes [BR:mmh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mmah_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 RUN
Motif
Other DBs
NCBI-ProteinID: ADE36291
UniProt: D5EAU0
LinkDB All DBs
Position
complement(794135..795265)
Genome map
AA seq 376 aa AA seqDB search
MKAVCICCEVHIPYDVKWYWPDESYSTVEFERFFDQHRIYSRFEKVVPDILSMNEALLES
IDRGASYTFNVSGIFLDQCRWHPAVIDSFRELKNRGAGFACSPYFHSVAALFPDSTEFRE
QVKMHRTKIEELFKYEPKTFINSELLIAKNIVPAIRDMGFSCYICEGSDNMIHEGGPLHV
YRGDMPTLMRHINLSEDIDTRFSDRGWVCYPLIADKFASWIANMEGDVVTLYFSFDSLIR
HHKKQSNISQFLAELPESLGKHGIDIISPQTAVNVFEHEHLETLKTNSTARYGLHNLVGN
HIQHLYIHELTIISKMLKDIRDSPDYSNLNYIYRCLQQSEILLEMGNENTNLGAERAVNI
FSIISDLKRAILEAGK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtatgcatctgttgcgaggtccatataccctatgatgtaaaatggtactgg
ccggacgaaagttattctacagtagaattcgaaagattttttgaccagcaccgaatatat
tccagatttgaaaaagttgtacctgatattctttccatgaatgaggcactgctggaatcc
atcgacaggggagcctcctacacttttaatgtctccgggatatttctggatcaatgtcgt
tggcatcctgctgtaattgattccttccgagagctcaaaaacaggggagcaggctttgca
tgttccccctatttccactcagttgcagccctgttccctgacagcacagaattcagggaa
caggtcaaaatgcataggactaaaatagaggaacttttcaagtatgaacctaaaaccttc
attaattcggaattgctaatcgccaaaaatattgttccagccatcagagatatgggattt
agttgttatatttgtgaaggatcggacaacatgatacatgagggaggtcccctacacgtg
tacaggggtgatatgccaacattaatgcgccacataaatctaagtgaggatatagataca
cgattttcggacagaggctgggtgtgctacccacttattgctgataaatttgcatcctgg
atagcaaatatggaaggtgatgttgtaaccctgtatttcagtttcgactctctgattaga
caccataagaagcaaagtaatataagccagtttttggccgagctaccggagagtctgggt
aaacacggtattgacataatatcaccacagacagcagtcaacgttttcgaacacgaacat
ctggaaaccctgaaaaccaattccacagcacgctacggattacataatctggtaggcaat
catatacagcacctctatattcatgaacttactattatcagcaaaatgttgaaggatatc
agggatagccctgattatagcaacctaaactacatataccgctgtcttcagcaaagtgaa
atcctacttgagatgggaaacgaaaatacaaatcttggtgccgagcgggcggtaaatatt
ttctccattatttctgacctcaaacgtgcaatactggaggcgggcaaatga

DBGET integrated database retrieval system