KEGG   Methanohalophilus mahii: Mmah_1965Help
Entry
Mmah_1965         CDS       T01211                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00970  Aminoacyl-tRNA biosynthesis
mmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mmah_1965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmh03029]
    Mmah_1965
Enzymes [BR:mmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mmah_1965
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mmah_1965
Mitochondrial biogenesis [BR:mmh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mmah_1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADE37460
UniProt: D5E8H2
LinkDB All DBs
Position
complement(1937465..1938886)
Genome map
AA seq 473 aa AA seqDB search
MLDGLSVIRNKIGSSSAEEVVASYLDRIEKSDINAFTCVAEDAIDQAKKADSLNIEGPLA
GVPIAIKDNISTRGLPTTCSSAILNGYVPPYDAHVIERLRKAGAVIIGKSNMDEFGMGTS
TETSTYGPTLNPWDTERVAGGSSGGSAAAVAAGQVPVSLGSDTGGSVRCPAAFCGTVGLK
PTYGAVSRYGLVSYANSLEQIGPLANRVEDIATLMDVIGTYDNRDSTCVNHDAGYTDALQ
DDVEGLKIGVPEEYFGEGIDDNVQKLVWDAIGKFEDMGAEYTKVSMPNTPYALAAYYIIA
MSEASSNLARFDGTRYGTRSEGENWHMMASKTRQEKFGAEVKRRILIGTYALSAGYHDKY
YLKALKVRTLVKQDFERAFEDVDVLMAPTMPTPAFKIGEKMDDPLSLYLSDVNTVPINLA
GVPSISVPCGFSEGLPVGLQVIGKYFDEATILKAANAFEKNTDHHTKLAGEVV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctggatggtttatctgttataagaaacaagataggttcctcatcagccgaggaagtt
gttgcctcctatctggatagaatagagaaaagtgacattaacgccttcacctgtgttgca
gaagacgctattgaccaggctaaaaaagctgactctctgaacattgaaggacctcttgca
ggtgtgcccattgcaatcaaggataatatttctaccaggggattacccacaacctgcagt
tctgccatcctgaatggttatgtgccaccctatgatgctcatgtgatcgaaagattgcga
aaggcaggtgcggtgataatcggcaaatccaacatggatgagtttggtatgggaacttcc
actgaaacaagtacctatggtccaactcttaacccctgggatacagaaagagtggccggt
gggtcctctgggggcagtgccgctgctgtggctgcagggcaggttcctgtttcactgggt
tcggatacaggtggttcggtacgctgcccggcagcattctgtgggactgtgggcctgaaa
cctacttacggggcagtctccagatacggccttgtatcctatgccaattccctggaacaa
atcggacctctggcaaaccgtgtggaagacatcgcaaccctgatggacgttattggtaca
tatgataaccgggattcaacttgtgtcaaccatgatgccggctatactgatgcccttcag
gacgatgtggaagggttaaagatcggagttcctgaagaatacttcggggaaggcatcgat
gataacgtacagaaactggtatgggatgccattggtaagttcgaggacatgggagctgag
tacacaaaagtttccatgccaaacacaccctatgcactggcagcatattatatcatagcc
atgagtgaagcctcctccaaccttgcccgttttgacggtactcgctatggcactcgttca
gagggggagaactggcatatgatggcctcaaagacccggcaggaaaagtttggtgcagag
gtaaaaaggcgtatcctgattggaacctatgctctttctgcgggctatcacgacaaatat
tatctaaaggccctcaaggtacgcacccttgtaaaacaggattttgaaagagcctttgag
gatgtggatgtattaatggcacccacaatgcccactcctgcctttaagataggggaaaaa
atggatgatcccctttccctgtatctttcggatgtcaacactgtcccgatcaatcttgca
ggggtaccttccatatcagttccatgtggcttttccgaaggtctgcctgtaggactgcag
gtaatcgggaaatactttgatgaagctactattctcaaagcagccaacgcctttgagaaa
aataccgatcatcataccaaactggccggagaggtggtataa

DBGET integrated database retrieval system