KEGG   Mycobacterium marinum M: MMAR_0511Help
Entry
MMAR_0511         CDS       T00694                                 

Gene name
sdhA_1
Definition
(GenBank) succinate dehydrogenase (iron-sulfur subunit), SdhA_1
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00020  Citrate cycle (TCA cycle)
mmi00190  Oxidative phosphorylation
mmi00650  Butanoate metabolism
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01130  Biosynthesis of antibiotics
mmi01200  Carbon metabolism
Module
mmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MMAR_0511 (sdhA_1)
   00650 Butanoate metabolism
    MMAR_0511 (sdhA_1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MMAR_0511 (sdhA_1)
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MMAR_0511 (sdhA_1)
    1.3.5.4  fumarate reductase (quinol)
     MMAR_0511 (sdhA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA AAA_lid_2 Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACC38975
UniProt: B2HN36
LinkDB All DBs
Position
complement(603413..605341)
Genome map
AA seq 642 aa AA seqDB search
MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN
SNPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRLKDGKISQRN
FGGHTYPRLAHVGDRTGLELIRTMQQKIVSLQQEDFAEVGDYEARIKVFAECTITELLKD
GPENGGRIAGAFGYWRESGRFILFEAPAVVMATGGIGKSFKVTSNSWEYTGDGHALALRA
GATLINMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSDDDRFMFGYIPPVFKGQY
AETAEEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRLTPEE
IKRRLPSMYHQFMELAGVDITKEPMEVGPTCHYVMGGIEVDADTGAATVPGLFAAGECSG
GMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPTVSPESVDAAARLALAPFEGPT
DGTAPENPYALQMDLQFLMNDLVGIIRNADEISKALTLLRELWARYEHVQVEGHRQYNPG
WNLAIDMRNMLTVSECVARAALERTESRGGHTRDDHPGMDPNWRNVLLVCRAAQEATDGS
HITITRQPQVPMRPDLLDLFQISELEKYYTAEELADHPGRRT
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtcgaacggcactcctacgacgttgtcgtgatcggtgccggcggcgcgggg
ctgcgggcggtcatcgaggcacgcgagcgcggcctgaaagtcgcggtcgtgtgcaaatcg
ctgttcggcaaggcccacacggtgatggccgagggtggctgcgcggccgcgatgggtaac
agcaaccccaaagacaactggaagacccacttcggcgacaccatgcgaggcgggaagttc
ctaaacaactggcgcatggccgaactgcacgccaaggaagccccggaccgggtctgggag
ctcgaaacctacggcgcgctgttcgaccgcctcaaagacggcaagatcagccagcgcaac
ttcggtgggcacacctatccgcggctggcccacgtcggtgaccgcaccggcctggagttg
atccgcaccatgcagcagaagatcgtgtcgctgcagcaggaggacttcgccgaggtcggc
gactatgaggctcggatcaaggtgttcgccgaatgcacgatcaccgagctactcaaagac
ggtcccgaaaacggcgggcggatcgccggagccttcggctactggcgggaaagcggccgc
ttcatcctgttcgaggcgcccgccgtggtgatggccaccggcgggatcggcaagtccttc
aaggtcacgtccaactcctgggagtacaccggcgacgggcatgccctggcactgcgggcc
ggcgcgacgttgatcaacatggagttcgttcagttccacccgaccggcatggtgtggccg
cccagtgtgaaggggatcctggtcaccgaaggtgttcgcggtgacggcggggtgctcaag
aactccgatgacgatcgattcatgttcggttacatcccgccggtgttcaaaggccaatac
gcggagaccgccgaagaagccgaccagtggctcaaagacaacgactcggcccgtcgcacc
cctgacctgttgccgcgagacgaggtggcccgcgccatcaactccgaggtcaaggcgggc
cggggcaccccgcacggcggcgtctacctcgacatcgcgtcgcggctgacccccgaggag
atcaagcgccggctgccgtcgatgtatcaccagttcatggagctggccggggtcgacatc
accaaggagccgatggaagtcgggccgacctgccactacgtgatgggcggcatcgaggtc
gacgccgacacgggcgcggccacggtccccgggctgttcgccgccggcgagtgctcgggc
ggcatgcacggctccaaccggctgggcgggaactcgctgtccgacctgctggtcttcggt
cggcgggccggcctgggcgccgccgactacgtgcgcgcgctgagcagccgtccgaccgtc
tcaccggagtccgtcgacgccgccgccaggctggccctggcgccgttcgaagggcccacc
gacggcaccgctccggaaaacccgtacgcgctgcagatggacctgcagttcctgatgaac
gacctggtcggcatcatccgcaacgccgacgagatcagcaaggcgttgaccctgttacgg
gagctgtgggcacgctacgagcatgtgcaggtcgaaggccaccgccagtacaacccgggc
tggaacctcgcgatcgacatgcgcaacatgctgaccgtcagcgagtgtgtggctcgggcc
gcgctggaacgcaccgagagccggggcgggcacacccgcgacgaccatcccggcatggac
ccgaactggcgcaacgtcttgttggtctgccgggccgcccaggaagccaccgacggttcc
cacatcaccatcacccgccagccgcaggtaccgatgcggccggacctgctggacctcttc
cagatttccgagctggagaagtactacaccgccgaagagttggccgaccatccaggacgg
agaacgtaa

DBGET integrated database retrieval system