KEGG   Mycobacterium marinum M: MMAR_1118Help
Entry
MMAR_1118         CDS       T00694                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase, GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00250  Alanine, aspartate and glutamate metabolism
mmi00410  beta-Alanine metabolism
mmi00430  Taurine and hypotaurine metabolism
mmi00650  Butanoate metabolism
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi02024  Quorum sensing
Module
mmi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MMAR_1118 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MMAR_1118 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MMAR_1118 (gadB)
   00430 Taurine and hypotaurine metabolism
    MMAR_1118 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MMAR_1118 (gadB)
Enzymes [BR:mmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MMAR_1118 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACC39574
UniProt: B2HD02
LinkDB All DBs
Position
1342284..1343669
Genome map
AA seq 461 aa AA seqDB search
MSRSHPSVPAHSIAPAYTGRLFTAPVPALRLPEESMDPEAAYRFIHDELMLDGSSRLNLA
TFVTTWMDPEAGKLMAETFDKNMIDKDEYPATAAIETRCVSMVADLFHAEGLRDDDPSSA
TGVSTIGSSEAVMLGGLAMKWRWRQKVGKDWKGRTPNLVMGSNVQVVWEKFCRYFDVEPR
YLPMEKGRYVITPEQVVDAVDEDTIGVVAILGTTYTGELEPVAEICAALDRLAAGGGVDV
PVHVDAASGGFVVPFLHPDLKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSPEYLPED
LVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYINVMQALSETARWLSAQLR
EVDHCELIADGSAIPVVAFRLAGDRGYTEFDLSHELRTFGWQVPAYTMPDNATDVSVLRI
VVREGLSADMARALHDDAVTSLRTLDKVKPGGNYDGQHFAH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgtagccacccgtcggtacccgcacattcgatcgctccggcctacaccggccgg
ctgttcaccgctccggtaccggcgttgcggctgcccgaggagtcgatggatcccgaagcc
gcctaccggttcatccacgacgagctgatgctcgacggtagctcgcggctgaacctggcc
accttcgtcaccacctggatggatcccgaggccggcaagctgatggccgagacgttcgac
aagaacatgatcgacaaagacgaatacccggcgaccgcggcgatcgagacccgctgcgtg
tcgatggtcgccgacctctttcacgccgagggactgcgcgacgacgacccgtccagcgcc
accggggtgtccaccatcggctccagcgaggcggtgatgctcggcggcctggccatgaag
tggcggtggcggcagaaggtcggcaaggactggaaaggccgcacaccgaatctggtgatg
ggctccaacgtccaggtggtgtgggagaagttctgtcgctacttcgacgtcgagccgcgc
tacctgccgatggagaaggggcgctacgtcatcacccccgaacaggtcgtcgacgccgtc
gacgaggacaccatcggtgtggtcgcgatcctgggcaccacctacaccggcgagctggaa
ccggttgccgagatctgcgcggcgctggacagattggcggccggcggcggcgttgatgtg
cccgtgcacgtggacgccgccagcgggggcttcgtggtgccgttcctgcatccagacctc
aagtgggacttccggctgccgcgggtggtctcgatcaatgtcagcggtcacaaatacggg
ctgacctatcccggcgtcggattcgtcgtgtggcgcagccccgaatacctgccggaggat
ctggtcttccgggtcaactacctgggcggggatatgcccacattcacactcaacttctcc
cggcccggtaaccaagtcgtcggccagtactacaacttcctgcggctgggccgggagggc
tacatcaacgtcatgcaggccctgtcggagaccgcgcgctggctctccgcgcagctgcgt
gaggtagatcactgcgagctgatagcggacggttcggcgatcccggtggtcgccttccgg
ctggccggcgaccgcggctacaccgagttcgacctctcccacgagctgcgaaccttcggg
tggcaggtgcccgcctacaccatgccggacaacgccaccgacgtatcggtgctgcgcatc
gtggtgcgcgaaggtctgtccgccgacatggcacgcgccctgcacgatgatgccgtcacc
tcactgcgcacgctggacaaggtcaagccgggcggcaactacgacggacagcacttcgcg
cactaa

DBGET integrated database retrieval system