KEGG   Mycobacterium marinum M: MMAR_1119Help
Entry
MMAR_1119         CDS       T00694                                 

Gene name
alr
Definition
(GenBank) alanine racemase, Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00473  D-Alanine metabolism
mmi01100  Metabolic pathways
mmi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MMAR_1119 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MMAR_1119 (alr)
Enzymes [BR:mmi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MMAR_1119 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mmi01011]
 Precursor biosynthesis
  Racemase
   MMAR_1119 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACC39575
UniProt: B2HD03
LinkDB All DBs
Position
1343756..1344922
Genome map
AA seq 388 aa AA seqDB search
MTTTPISLTPGVLAEAVVDLGAIAHNVRLLRERAGSAQVMAVVKADGYGHGATAVARTAL
AAGAVELGVASVDEALTLRADGITAPVLAWLHAPGMDFGPALAADVQIAISSIRQLDEVL
DAARRTGTTATVTVKIDTGLNRNGVAPALYPEMVTRLRQAVAEDAIRLRGLMTHMVHADA
PEKPINDIQSQRFKQMFDHARDQGVRFEVAHLSNSSATMARPDLTLDLVRPGIAVYGLSP
VPRLGDMGLVPAMTVKCAVALVKSVSAGEGVSYGHTWIAPHDTNVALLPIGYADGVFRSL
GGRLEVLINGKRRPGVGRVCMDQFLVDLGPGPLDVAEGDEAILFGPGTRGEPTAQDWADL
VGTIHYEVVTSPRGRITRVYREAETVER
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaccccgatatctctgacgcccggggtcctcgccgaggcggtggtggacctg
ggcgctatcgcccacaacgtgcggctgctgcgcgaacgtgccggcagcgcacaagtcatg
gcggtcgtcaaggccgatggctatggtcacggcgccaccgcggtcgcccgcaccgcgctg
gcagccggtgcggtcgaactcggagtcgcgtcggtggacgaggcgctgacgttgcgcgcg
gacggcatcaccgccccggtgctggcctggttgcacgcacccggcatggatttcgggccc
gcgctggccgccgacgtccagatcgccatttcttcgatccgccaactcgacgaagtgctc
gatgccgcgcgccggaccggaacgacggcgaccgtcacggtcaagatcgacaccggcctc
aaccgcaacggcgtggcgccggcgctctacccggagatggtgaccaggctgcgccaggcc
gtcgccgaagacgcgattcggctacgcgggctgatgacgcacatggtgcacgccgacgca
ccggaaaagccgatcaacgacatccagtcccagcggttcaagcagatgttcgaccacgcc
cgcgaccagggagtgcgattcgaggtggcacacctgtcgaactcctcggcaaccatggct
cgtcccgatctgacgctggatctggtgcggcccggcatcgcggtgtacgggctgagcccg
gtgcccaggttgggcgacatgggactggttccggcgatgaccgtgaaatgcgcagtcgcg
ctggtgaaatcggtgagcgcgggcgaaggcgtgtcgtacgggcacacctggattgcgccc
cacgacacgaatgtggcgctgttgccgatcggctacgccgacggggttttccggtcgctg
ggcgggcgcctggaggtcttgatcaacggcaaacgccggccgggcgtcggccgggtctgc
atggaccagttcctcgtcgatctgggccccggaccgctcgatgtggccgaaggcgacgag
gcgattctgttcgggccgggtacccgcggtgaacccaccgcgcaggactgggccgatctg
gtcggcaccatccactacgaggtggtgaccagcccgcgcgggcgcatcaccagggtttac
cgcgaggccgaaaccgttgagcgctga

DBGET integrated database retrieval system