KEGG   Mycobacterium marinum M: MMAR_1733Help
Entry
MMAR_1733         CDS       T00694                                 

Gene name
ddlA
Definition
(GenBank) d-alanine--D-alanine ligase DdlA
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00473  D-Alanine metabolism
mmi00550  Peptidoglycan biosynthesis
mmi01100  Metabolic pathways
mmi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MMAR_1733 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MMAR_1733 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MMAR_1733 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mmi01011]
    MMAR_1733 (ddlA)
Enzymes [BR:mmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MMAR_1733 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:mmi01011]
 Precursor biosynthesis
  Amino acid ligase
   MMAR_1733 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 RimK CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACC40182
UniProt: B2HII8
LinkDB All DBs
Position
2086827..2087948
Genome map
AA seq 373 aa AA seqDB search
MSGSSRRGERLRVAVVFGGRSNEHAISCVSAGSILRNLDPRRFEVIAIGITPQGSWVLTD
GNPDALAITDRRLPEVSSQSGTELALPADPRWGGQLVSLPPGAGEVLASVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLWSAAGLPIGPHAVLRPSRQSLD
REELQRLGLPAYVKPARGGSSIGVSRVSSFDELPAAIAAARRHDPKVIVEAAINGRELEC
GVLEFPDGRLEASTLGEIRVAGVRGREDGFYDFETKYLDDAAELDVPAKVEDDVADAVRQ
LAIRAFEAIDCQGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLAT
MVETALSRGIGLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcagcagccggcgtggcgaacgtctccgggttgccgtcgtgttcggcggacgc
agcaacgagcatgcgatctcatgcgtgtctgcgggcagcattctgcgcaatcttgacccg
cgacgcttcgaggtgatcgcgatcgggatcaccccgcaaggctcgtgggtgctcaccgac
ggcaacccggatgcgctggcaatcaccgaccggcggctacccgaggtgagctcccagtcc
ggcaccgagctggccttgccggcagatccgcgctggggcggccaattggtctcgttgcca
cccggtgccggagaggtgctggcctcggtcgacgtggtgtttccagtgctgcatggaccg
tacggcgaggacggaacgatccagggactactcgaactcgccggcgttccctatgttggc
gccggggtgctggccagcgcggccggtatggacaaagagttcaccaagaaactgtggagt
gcggcggggctaccgatcggcccgcatgccgtgctgcgcccatcgcgacaatcgctggac
cgcgaggaactgcagcggctggggttgccggcttacgtcaaacccgcgcgcggcggctcc
tcgatcggtgtcagccgggtctcgagcttcgatgagctgcccgccgcgatcgccgccgcc
cggcgacacgatccgaaggtgatcgtcgaggccgcgatcaacggtcgcgagctggagtgc
ggcgtgctcgagttccccgacggcagattggaagccagcaccctgggagagatccgggtg
gccggggtgcgtggacgcgaagacggcttctatgactttgagaccaaatacctcgacgac
gctgccgaattggacgtgccggccaaggtcgaagacgacgtcgctgacgcggtgcgccag
ctggcgattcgcgctttcgaggccatcgactgccaaggcctggcccgagtcgacttcttc
ctcaccgacgacggcccggtgatcaacgagatcaacacgatgccggggttcaccacgatc
tcgatgtacccgcggatgtgggcggccagcggggtcgactatcccaccttgctggccacc
atggtggagaccgcgttgtcgcggggcatcggcctgcgctaa

DBGET integrated database retrieval system