KEGG   Mycobacterium marinum M: MMAR_3099Help
Entry
MMAR_3099         CDS       T00694                                 

Definition
(GenBank) polyketide synthase and peptide synthetase
Organism
mmi  Mycobacterium marinum M
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt AMP-binding KR Acyl_transf_1 PS-DH Ketoacyl-synt_C PP-binding ADH_zinc_N ADH_zinc_N_2 adh_short adh_short_C2 KAsynt_C_assoc Thiolase_N Epimerase ADH_N GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 AMP-binding_C_2 NmrA
Motif
Other DBs
NCBI-ProteinID: ACC41534
UniProt: B2HFX0
LinkDB All DBs
Position
complement(3772823..3781318)
Genome map
AA seq 2831 aa AA seqDB search
MSLILDRVRELGTQIPDAAALSFVNDRGLVTESMSRVDVVTEMNKVAQFVRQDCGLAPGD
RAVLVYPPGLDFVCGLLGCMAAGVIAVPVFPPDPINPQKSGAAFRRVALDCGATAVLTSH
HYADARQLEVAAPVGTAFDEDWPNALPWHVTSRGASGRGKSAPRAVSEAISEWAPSPQTP
ALLQYTSGSTSDPKGVVITHGNVVHQAEFNRRFIGLGPGHRAVFWVPPYHDFGLISGILS
ALAGNFDLTMMSPMSFIQRPALWFEVMDRVRATVTVAPNFGFELAMRKTTAEQRAGWDLS
PLQVIVSAAEPVREDTTRRFFEAFAASGIRREAFCPCYGLAEHTVGITVSGRSSLRVDRS
QLEARQLAVPSDAPDAQVLMGCGQPTDDVDVRIVDPELCVPLGDGQVGEIWADSPSKAAG
YWGLSAKSRATFQAALAGVEGGRGYLRTGDLGFLHDGELYVCGRIKDLLILAGRNIYPQD
IEDSLRDCHPAIRPGGFAAFAVVDGNSETLAVLVEVRTDGSPDLLAGVVAAIRAAVLKDH
QLRCGVVVLGPPGSVSKTTSGKVQRSRCRARFLDGTLQAQALLVDRRTDDEPVGAAPTTE
QLLSVVCGQAAEVLGIGAASVDIDRSLGDQGLNSIGVTELASRLTQVLGQDVQPVDIFNH
PTVGDLVQILSPGEKTRHQRGVRERLGHHAASGAGAVALPADPVAIVGIGCRFPGGVDSA
DSLWDMVVSARDVISDFPGDRGWDAGRLFDPDPDALGKTYCAVGGFLEDAAGFDAGFFGI
APREALAMDPQQRVLLEVSWEALEDAGIDPKALRGSATGVFVGTWAQPYGDGGSDSADGY
AMTGTATSVASGRVAYVLGLEGPAVSVDTACSSSLVAVHQAVQSLRLGECDLALAGGVTV
MATPSVFVGFSRQRGLAPDGRCKAFAEAADGVGWGEGAGVLVLQRLSDARRQGRVVLGVV
RGSAVNQDGASHGLTAPNGPAQQRVIRAALAGAGLGPADVDVVEAHGTGTRLGDPIEAQA
LLAVYGQDREPGRPLWVGSIKSNMGHAQAAAGVAGVIKMVQAMRHGLLPETLHVDEPSGQ
VDWSAGAVEVLSRARSWLGVPGRPRRAGVSSFGISGTNAHVIVEQALPEVAESGGVSGVC
GQGVGSVESVVRASVVPWVLSAQSRQALVAQASRLLGRVGGDDGLDPVDVGLSLAQRCVF
EHRAVVVGRDREALLAGLTGLARGGPGAGVVVGQAAAVGKTVLVFPGQGAQWTGMGRGLH
GQFPAFARAFDAAVDELDQHLPMPLREVMWGTDKGLLDSTEFAQPALFALEVGLWALLEH
WGIRPDFVLGHSVGELSAAHVAGVLSLADAAMLVAARGRLMQGLPAGGVMVALGVGEQEV
DPLLAESAHPVSIAAINAPEQVVISGAQAAVMTIADQLAARGHRVQQLAVSHAFHSPLME
PIVEEFAEIAGRVTVEAPRIGVISNLTGELAGPGYGSKAYWREHIRRPVRFSDSVACARA
QGATHFVEAGPGAGLTAAIEQSLGSVAATVVAVLGKQRPEPDSLLDAAAQLFASGARLDW
PAVFLGWGGRRVSLPTYAFMRQRFWLTPHLAGSVGAAELGSGNPRHPLLDAVVEHPDSGE
VILAGRLSRRAQPWLADHVIGGLVLLPGTGFVELVIRAGDQLGCAAIDELTLTNPLIVPD
GSEVQVQVVVGAAERSGRRTVSVYSRADHIGAAWVQHAEGALGVDPMPASGDFSVWPPSG
AEAVRVSDAYERLAQLGYRYGPAFRGIEAIWRRGTEVYAEVAIPADAELGINGYGIHPVL
LDAVLQAAAVAVDSGDTRLPYSWRGISLHAAAAKRIRARIAPVGEVGYAVECADVAGLPV
LTMGSLVTRPVSAEQLHAGAATAIGRPAQGLLELAWSPISPAHGALDGGGHQTVLSWADF
TAGAAAAADGVGGRAVAVVWESRTAETDVVGSVYARIHAALSVLQHWLAQDQLASLVVVT
HGAVGLPGEAITDLAGSAVWGLARSAQAESPGRIVLVDIDTPNTPDLGVLLAGREPQLVV
RGDSVFCARLRPVEAPLEVPVGQSAWQLSTGGGGTLADIVVQPCPPAQAPLEPGQVRVAV
AAAGVNFRDVLMALGMYPGAQPVLGGEGSGVVLEVGPQVSGVGVGDAVMGLIAGVGPLAV
VDARLLVRVPSGWSLAEAAGVPVAFLTAWYGLADLAGVRAGESVLVHAGTGGVGMAAVQL
ARLWGAKVFVTASRGKWDTLRSMGFDDSRIGDSRSLEFAEKFFAATRGRGVDVVLNSLAG
EFVDASLRLLAPGGRFIEMGKTDIRDPQQIAVEYPGVIYEAFDLIEAGPARIQPMLGQLH
TLFEASALESLPTRTWDARCAPAAYRFVSQARQIGKVVLTMPTQISDAVAAGTVLITGGT
GMVASVLARHLVSSYGVKHVVLASRRADATAGVAELVADLAAAGAAVAVVACDVADRAAV
TRLLDHVSTCHPPLTGVIHAAGTLDDAVIASLTPDRVDAVLRAKVDGAWNLHEATRHLGL
SMFVLCSSIAATVGSSGQANYAAGNAFLDGLAAYRRAGGLPGMSLGWGLWEQSSTMTAHL
SDRDMARIRRIGLAAISPEQAMQLFDAALAVGQPTVLAAHLDHAVLANHTLSSTLPPLFS
TLIKRPLRRLVDNDTPSSTAGFAQRLYGLKPEKQQDLLVDLVCTQAAAVLGHPSATDLNP
ASTFQNMGFDSLTAVELRNRLKTVTGLGLSPTLVFDHPTPTALAGLIAELIGIAAKGLSP
LEEALNNVEETLPAIEAGDKHRVADRLRALLSTITDEEHRLDERIQAASTLDEVLLLVDS
ELANLEKGPGL
NT seq 8496 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgatattggaccgggttcgggaactgggaacgcaaatcccagacgccgctgcc
ctctcttttgtgaatgatcgaggcctggtcaccgaatcgatgagtcgcgtcgatgtggtg
accgaaatgaataaggttgcccagttcgtgcggcaggattgcggcttggcgcccggagat
cgggcggtcttggtgtatccgcccggtctggacttcgtgtgtggattgctggggtgcatg
gcggccggggtaatcgcggtgccggtgttccccccggacccgatcaacccacaaaagtcc
ggcgcagccttccggcgggtggcactcgactgcggtgcaacagcggtcctgaccagccac
cactatgccgatgctcggcagctagaagtggccgctccggtggggaccgccttcgatgag
gactggccgaatgcccttccctggcacgtgacatcgcggggggccagtgggcgcggaaag
agcgccccgcgggccgtgagtgaggcgatctcagagtgggcccccagcccgcagacgcct
gccctactgcagtacacctcgggttcaacatcggaccccaagggtgtggtcatcacccat
ggcaacgtggtgcatcaggccgagttcaaccgccgcttcatcggactcggcccgggccat
cgggctgtcttctgggtgccgccgtaccacgacttcggcctcatcagcggcattctgagc
gcgttggccggcaatttcgacctcaccatgatgtcgccgatgagctttatccagcgccct
gccttgtggtttgaggtcatggaccgggttcgcgccaccgtcactgtcgcacccaacttc
ggattcgagttggcgatgcgcaagaccactgccgagcagcgcgctggctgggatctgagc
ccattgcaggtgatagtgagtgccgcggaaccagtgcgcgaggacaccacccgccgcttc
tttgaagcctttgccgcctcagggatccgccgggaagccttctgtccgtgctacgggctt
gcggaacacaccgtcggcatcaccgtgtccgggcgctcgagcctgcgggtggatcgctcc
cagctggaagcgcggcagttggcggttcctagcgacgctcccgatgcccaggtcctgatg
ggctgcgggcagccaaccgatgacgtggatgtgcgcatcgtggaccccgagctatgtgtt
ccactcggcgacggacaggtgggggagatctgggcggactcgccgagcaaagccgccggc
tactggggattgtcagcgaaaagccgtgccacgtttcaggctgcgttagccggggtcgag
ggtggccgcggctacctgcgaacgggggatctgggctttctgcacgacggtgagctgtat
gtgtgtgggcgaatcaaggatctgctgatcctggcggggcgcaacatctatccgcaagac
atcgaggacagcctgcgagattgccaccccgcgatcaggccgggcgggttcgcggctttc
gccgtagtggacggcaacagcgagacgctggcggtgctggtcgaggtgcgcaccgacggg
tcgcccgacctgctcgcaggggtagtggcagcgatccgggcggcggtgttgaaagaccac
cagctgcgctgcggggtggtagtgctggggccgccggggagcgtgagcaagacgaccagc
ggcaaagtgcagcgctcgcggtgccgcgcccgctttctcgacggcaccttgcaagcccaa
gcgctgctggtggaccgccgcacagacgatgaacccgttggcgccgcgcccacgaccgag
cagctgctatcggtggtgtgcgggcaggcggccgaggtcttgggtatcggcgcggccagt
gtggatatcgatcgatcgctgggggatcagggcctcaactcgatcggagtcaccgagttg
gcgtcgcggctaactcaggtgctgggccaagacgtgcaacccgtagacatcttcaaccat
cccacggttggagatctggtccagatcctgagccccggtgaaaagacacgtcaccagcgt
ggagtgcgagaacggttggggcatcatgcggcgagtggcgctggcgcagtggcgcttccg
gcagacccggtggccatcgtcggtatcgggtgccggtttccgggtggggtggattcggcg
gactccttgtgggacatggtggtgtcggcccgggatgtgatttcggattttccgggtgat
cggggctgggatgcggggaggttgtttgatccggatccggatgcactgggtaagacgtat
tgcgcggtgggcgggttcttggaggatgcggccggctttgatgccgggttcttcgggatc
gccccgcgcgaggcgctggcgatggatccccaacagcgggtcttgctagaggtgtcgtgg
gaggcgttggaagatgccgggattgacccaaaggcgctgcggggaagcgctaccggggta
ttcgtgggcacctgggctcagccctatggggatggcggttcagacagcgcggatggatat
gccatgactggcaccgccaccagtgtggcttcggggcgggtggcgtatgtgttggggttg
gaggggccggcggtgtcggtggataccgcgtgttcttcgtcgttggtggcggtgcatcag
gctgtgcagtcgttgcggttgggggagtgtgatctggcgttggctggtggggtgacggtg
atggcgacgccgtcggtgtttgtggggttttctcggcagcgggggttggctccggatggg
cggtgtaaggcgtttgcggaggctgcggatggggtggggtggggtgagggtgcgggagtg
cttgtcttgcagcggctctcggatgcgcgtcggcagggtcgtgtggtgttgggggtggtg
cgtgggtctgcggtgaatcaggatggggcttctcatgggttgacggctccgaatgggccg
gcgcagcagcgggtgattcgggcggcgttggctggtgcggggttggggcctgcggatgtg
gatgtggttgaggctcatgggacgggtaccaggttgggggatccgattgaggctcaggcg
ttgttggcggtttatgggcaagatcgtgagccgggtcggccgttgtgggtgggttcgatc
aagtcgaatatgggtcatgctcaggcggcggcgggggtggccggggtgatcaagatggtg
caggcgatgcgtcatgggttgctgcctgagacgttgcatgttgatgagccctcggggcag
gtggattggtcggcgggggcggttgaggtgttgagtcgggcgaggtcgtggctgggtgtg
ccggggcgtccgcgtcgggctggggtgtcttcgtttgggattagtggcactaatgcgcat
gtgattgttgagcaggcgttgcctgaggtggccgaaagtggcggtgtgtcaggggtttgc
gggcagggggtgggctcggtcgagtcggtggtgcgggcgtctgtggtgccgtgggtgttg
tcggctcagtcgaggcaggcgttggtggctcaggcgagtcggttgttgggtcgtgtcggt
ggtgatgatggcctcgatcccgttgatgtggggttgtcgctggcgcagcgttgcgtcttt
gagcatcgcgcggtggtcgttggtcgggatcgggaggcgttgctggcggggttgaccggg
ctggcgcgcggtgggccgggtgctggtgtggtggtgggtcaggccgcggcggtgggcaaa
acggtgctggtgttccccggccaaggcgcccagtggaccgggatgggccgcgggctgcat
gggcaatttccggcattcgcccgagcctttgacgcggcggttgacgaactggatcagcat
ttgccgatgccgctgcgcgaggtgatgtggggaaccgacaaggggttgctggacagcacc
gagttcgcgcagccggcgttgttcgccctcgaggttggattatgggcgttgttggagcac
tggggaattcgcccggatttcgtgttgggacattcggtgggggagctgtcggcagcccac
gtggccggggtgctgagtttggcggacgcggcgatgttggtggctgcgcggggccgattg
atgcagggtctaccggccggcggggtcatggttgccttgggcgtcggcgagcaagaagtg
gacccgttgcttgccgaatctgcccaccctgtgagcattgcggccatcaacgccccagag
caggtggtgatctcgggtgcgcaggctgcggtgatgacgattgcggatcagctggcagct
cgcggccaccgggtacagcaattggcggtgtcgcacgccttccattcaccgttgatggaa
cccatcgttgaggaattcgcggagattgccggtcgggtcacggtggaggcgccgcggatc
ggggtgatctccaatctgactggcgagctagccggacccgggtacggctcgaaggcctac
tggcgcgagcacatccgccgaccggtgcgtttcagcgacagcgtggcatgtgcccgcgcg
cagggggcgacccatttcgttgaggccggtccgggcgctgggttgactgccgccatcgaa
cagtcgctgggctcggtagcggcaacggtggtggcggtgctgggcaagcagcggcccgag
ccggattcgctgctggacgcagccgctcaactgtttgccagtggcgcgcggctggactgg
cctgcggttttcctgggctggggtggccgtcgggtgtccttgcccacctatgcgtttatg
cgacagcggttttggctgacgccacatctagccgggtcggttggcgcggccgagctgggg
tcgggaaacccacggcacccgctgctggatgcggtggttgagcaccccgattcgggggag
gtgattctggccggacgcctatcgcgtagggcccagccgtggttggccgatcacgtgata
ggcgggctggtgctattgccgggcaccgggtttgtggagttggtgatccgagccggtgat
cagctcggctgcgcggccatcgacgaactgacgttgacgaacccactgatcgtgccggac
ggctccgaggtacaggtgcaggtggtagtgggtgcggccgagcgctcgggccggcggacg
gtgtcggtgtattcgcgtgccgatcacatcggtgcggcctgggtacagcacgccgagggt
gcgctaggggtcgacccgatgcctgcgtcgggggatttttcggtatggccgcccagcggt
gcggaggcagtgcgggtgtcggacgcctatgaacggctggcacaacttggctatcggtat
gggccggcatttcgcggaatagaggcgatttggcgacgcggcacagaggtttatgccgag
gtcgccatcccggccgatgccgagttggggatcaatggttatggcatccatccggtgctg
ttggacgcggtgctgcaggcggccgcagtggccgtcgatagcggtgacacccggttgccg
tactcatggcgagggatatccctgcatgccgcggccgccaaacggatccgggcccgtatt
gccccggtgggcgaggttgggtacgcggtggaatgcgccgatgtggcggggctgccggtg
ctgacgatggggtcactggtgacccgcccggttagtgccgagcagctacacgccggagcc
gccaccgcgatcggtcggcccgcgcagggactgctggagctggcgtggtcaccaatatcg
ccggcgcacggggctcttgatggtgggggccatcaaacggtgttgtcctgggctgacttt
accgctggcgcagctgcagccgctgatggcgttggcggtcgcgcagtggcggtggtgtgg
gagtcccgaactgccgaaaccgatgtggtgggctcggtgtacgcgcgcatccatgctgcc
ctatccgtgttgcagcactggctggctcaggatcagctagccagcttggtggtggtgacc
catggcgcggtgggactacccggtgaggcgatcaccgatctggccggttcggcggtgtgg
ggattggcgcgttcggcacaagccgagagcccgggccgcattgtgctggtggacatcgac
acccccaacacaccggatctaggtgtgctgctagccggccgggaaccccaactggtggta
cgcggcgacagcgtgttctgcgcgcggttgcgcccggtcgaggccccgctggaggtgccg
gtcgggcaatcggcctggcagctgagtaccggtggcggcggcacgctggctgacattgtg
gtgcagccctgtccaccggcgcaggcaccgctggagccggggcaggtgcgggtggcggtg
gccgcggccggcgtcaatttccgggatgtcttgatggccttagggatgtatcccggtgcg
cagccagtgctcggtggtgagggttccggagtggtgctcgaggtcggcccgcaggtcagc
ggtgtgggtgtcggagacgcggtgatggggctaatcgccggcgtggggccgttggcggtg
gtggatgcgcggctgctggtgcgggtgcccagtggatggtcattggctgaggccgccggg
gtgccggtggcgttcttgaccgcctggtacgggttggccgacctggcgggggtgcgggct
ggggagtcggtgttggtgcatgccggcaccggcggggtgggaatggctgcggtgcaattg
gctcgcctctggggggcaaaggttttcgtaacagctagtcgaggcaagtgggacacgctg
cggtccatgggttttgacgacagccgaatcggcgattcgcgtagcttggagtttgccgag
aagttcttcgcggcgaccaggggccgcggggtggatgtggtactcaattcgctggccggt
gagttcgtcgatgcctcgctgcggttgttggctccaggcgggcgcttcatcgagatgggt
aagaccgatatccgcgatccgcagcagatcgccgtcgagtatcccggtgtgatctacgag
gcgtttgacttgatagaggccggcccggcacgcatccaaccgatgctcggtcagctacac
accctgtttgaggcatccgcattggagagcctgccgaccagaacctgggatgcgcgctgc
gcgccggccgcataccggtttgtcagccaggcccgccagatcggcaaagtggtgctgacc
atgcccacccagatatcggatgcggtcgcggcgggcacggtgttgatcaccggtggaact
gggatggtcgcatcggttttggcgcgccatctcgtcagcagctatggggtcaagcatgtg
gtgttggctagccggcgtgcagacgcgaccgcgggtgtagcagagttggtcgccgatttg
gccgcggccggtgcagcggtggcggtggtcgcctgtgacgtggccgatcgggccgcggtg
acgcggttgctggatcacgtatccacctgccatccgccgttgaccggggtgattcatgcc
gccggcacccttgacgacgcggtaatcgcctctttgacaccagatcgggtggatgcggtg
ttgcgggccaaagtggatggcgcctggaacctgcatgaggccactcgtcatttggggttg
tcgatgtttgtgctgtgttcctcgatcgcggccaccgtcggatcatcggggcaggccaac
tacgcggccggcaacgcattccttgacggcctcgccgcctaccggcgggccggcgggctg
ccgggtatgtcgctggggtggggactatgggaacagtccagcaccatgaccgcgcatttg
agcgaccgcgacatggcccgaatacgccgtattgggctggccgccatcagccccgagcaa
gccatgcaactattcgatgccgcactggcggtcggccagcccaccgtgctggccgcccac
ctcgaccacgccgtgctggcaaatcacaccctgagtagcacgctgccgccgctattcagc
acgctgataaagcgtccgttgcgccgcctcgtcgacaacgacaccccctcgtccacagca
ggtttcgctcaacgcctgtacgggctcaaacccgagaagcagcaggacctactggttgac
ctggtgtgcacccaagcggccgcggtgctcgggcaccccagcgccacagacctcaacccc
gccagcacgtttcaaaacatggggttcgactcactcaccgccgtggagctgcgtaaccga
ctgaaaaccgttaccgggctcggcctgtcgcccaccttggtcttcgatcatcccacgccc
accgcgctggcggggctcatcgccgaactcatcggaattgccgccaagggtctctcacca
ctggaagaagcattgaacaacgtcgaggaaacgctgccggccatcgaggccggcgacaag
caccgagtggccgatcgcttgcgcgccctcctgagcacaatcaccgacgaagagcatcgc
ctagacgagcggatccaggccgcttcgacacttgacgaggtgctcctgctagtcgactcc
gagctcgcgaatcttgaaaaggggccagggctatga

DBGET integrated database retrieval system