KEGG   Mycobacterium marinum M: MMAR_3328Help
Entry
MMAR_3328         CDS       T00694                                 

Gene name
adhE2_1
Definition
(GenBank) zinc-dependent alcohol dehydrogenase AdhE2_1
Organism
mmi  Mycobacterium marinum M
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ACC41754
UniProt: B2HHQ6
LinkDB All DBs
Position
4107646..4108728
Genome map
AA seq 360 aa AA seqDB search
MRAVLMQDSQLQVAEVPEPVPGPGEVLVDVLACGICGSDLHCAAHGPEFNSATQAAGGFD
MMDLSRPVVFGHEFVGRIAAYGPDTVQRIPVGRRVVSAPFLLREQKVTLGFAGPEAPGGY
SERMLLSEPLLIEVPDHVPTEVAALTEPLAVAYRTVARVDTTTDDVALVVGCGPIGLAVI
AVLKMKGVGPIVASDFSPERRALATQLGADVVLDPNENSPFEAFMAAAVTDDPARMAPAH
TVFGQLPLRPTVAFECVGVPGLIQQLIAGVPPGTRIGVAGINMSSDHFEPAQCIAKELDI
RFSLYYTLEEFAQTFAHLAAGDFDVAPLLTGTVALEGVADAFERLRNNPHDAKILLDPTR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggttttgatgcaggactcccagctgcaggtcgccgaggtgcccgagccggtg
cccggccccggcgaggtgctggtcgatgtgctggcctgtggcatctgcggatcggacctg
cactgcgcggcgcacggcccggaattcaactcggccacccaggccgcgggtggattcgac
atgatggatctcagccgtccggtggtattcggacacgagttcgtaggccgcattgcggcc
tacggacccgacaccgtccaacgcatcccggtcggccgccgcgtggtctcggcaccgttt
ctgctccgcgagcagaaggtgaccctgggcttcgccggccctgaggcacccggcggctac
agcgagcgcatgctgctgtccgaaccgctgctgatcgaggtgcccgatcacgtgccgacc
gaggtcgccgcactgaccgaaccactggcggtggcctaccgcacggtggcccgcgtcgac
accaccaccgacgacgtcgccctggtggtcgggtgcggaccgatcgggctcgccgtcatc
gcggtgctcaagatgaaaggcgtcggccccatcgtcgcgtcggacttctctcccgaaagg
cgagcactggcaacacaactcggtgccgacgtggtcctcgacccgaacgagaactccccg
ttcgaggcgttcatggcggccgcagtcaccgacgacccggcacgaatggcgcccgcgcac
accgtgttcggacagttgccgcttcgtcccaccgtcgcgttcgaatgcgtcggcgtcccc
ggcctgatccagcagctcatcgccggtgtcccgcccggcacccggatcggcgtggcgggc
atcaacatgagctcggatcacttcgagcccgcccaatgcatcgccaaggaactcgacatc
cgcttctcgctgtactacacgctcgaggagttcgcgcagaccttcgcccacctggccgcc
ggcgatttcgacgtggccccgctgctgaccgggaccgtcgcgttggaaggcgtcgccgac
gccttcgagcggctcaggaacaacccgcacgacgcgaagatcctgctcgacccgacgcgc
tga

DBGET integrated database retrieval system