KEGG   Mycobacterium marinum M: MMAR_3965Help
Entry
MMAR_3965         CDS       T00694                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
mmi  Mycobacterium marinum M
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACC42373
UniProt: B2HPM1
LinkDB All DBs
Position
4891606..4893096
Genome map
AA seq 496 aa AA seqDB search
MTADSTHRSFHELFIGGRWCKPTIAEPITVISPHSEEPIGRAPAAGPDEVEAAVAAARRA
FDYGPWPRLDPDERIRKVEELAAIYASHLDDMADLITAEMGSPHSFSRLGQAAGAAGLMQ
LALAAGRNFPWVERRQGIRGQAHLRRAPVGVVGAIVPWNVPQFLIMPKLIPALIAGCTVI
IKPAPETPLDALWLAEMIEQIELPEGVVSVLPGGPSVGEALVRHPGVDKIAFTGSSATGR
RIAALCGEGLKRVSLELGGKSAAIILDDADIGKTVAGLKTAGLMNNGQACVAQTRILVSE
RRHDEVVDALADMMSALQVGDPADEKTDVGPLVAQRQQRRVRDYIRSGQQEGARIVLGGQ
DSPQDRGWYVRPTLFTDATNDMCIAREEIFGPVLTVLTYRDEQDAIRIANDSDYGLAGSV
WTADTAHGLEIAAAVRTGTYGINMYTLDISAPFGGFKQSGIGREFGPEGLAEYVELQTVL
CSGKMPPLRGFEEPAG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgattccacgcaccgttcgtttcacgagctgttcatcggtggacgctggtgc
aaacccaccatcgcggagccgatcaccgtgatttccccacactcggaggaaccgatcggg
cgggccccggcggctggccccgacgaagtcgaggcggccgtggccgccgcgcggcgcgcc
ttcgactacggtccgtggccacggctggatccggatgagcggatacgcaaagtcgaagag
ttggccgcgatctacgcgagccacctcgatgacatggctgacctgatcaccgcggaaatg
ggctcgccgcacagtttcagcaggctgggccaagcggccggagcagcgggcctgatgcag
ctggcactggcggcgggccgcaacttcccctgggtggagcggcgccagggaatacgcgga
caggcgcacctgcgtcgggccccggtcggggtggtcggggcgattgtgccgtggaacgtg
ccgcaattcctcatcatgcccaagctgatccccgcactgatcgccggttgcaccgtgatc
atcaagccggctcccgaaacccccttggacgctttgtggttagccgagatgatcgaacag
atcgagctacccgagggcgtcgtatcggtgcttcccggcggaccgtcggtcggcgaggcg
ctggttcgccatcccggggtcgacaagatcgcgttcaccgggtccagcgccacgggccgt
cggatcgccgccctgtgcggcgaaggactcaaacgggtgagcttggagctgggcggaaaa
tccgccgcgatcatcctcgacgacgccgacatcggcaagaccgtcgccgggttgaaaaca
gcaggattgatgaacaacgggcaggcctgcgttgctcagacccgcatcctggtgagcgaa
cgccgtcacgacgaagtcgtcgacgccctggccgacatgatgtcggcgctgcaggtcggc
gatcccgccgatgagaagaccgatgtcgggcccctggtcgcgcagcgacaacaacgtcgg
gttcgcgactacattcgctccggtcagcaggaaggcgcacgcatcgtgctcggcggccag
gacagcccacaggaccgcggctggtacgtgcggcccaccctgttcaccgacgccaccaac
gacatgtgcatcgcccgggaggagatattcggaccggtcctgactgtcctgacctaccgg
gatgaacaggacgcgatccggatcgccaacgacagcgactacggcctggccggttcggtg
tggaccgccgataccgcgcacggactcgaaatcgccgcggcggtgcgtaccggcacctat
ggcatcaacatgtacacgctggacatcagcgcaccattcggcgggttcaagcagtcgggc
atcgggcgtgagttcggccccgaggggcttgccgaatacgtcgagctgcagacggtgctg
tgtagcggaaaaatgccaccactcaggggctttgaggaacctgcagggtga

DBGET integrated database retrieval system