KEGG   Mycobacterium marinum M: MMAR_5266Help
Entry
MMAR_5266         CDS       T00694                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
mmi  Mycobacterium marinum M
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ACC43670
UniProt: B2HLD8
LinkDB All DBs
Position
6356933..6358009
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPISPMLAKAVKTIPADASYEPKWDGFRSICFRDNDEVELGSRNERPLTRYFPE
LVAAVRAELPRRCVLDGEIVIATGHGLDFEALQQRIHPADSRVRMLAEHTPASFIAFDLL
ALGDDDYTTRPFVERRAALVEAVGSGPSIHVTPATTDQATARRWFEEFEGAGLDGVIAKP
LAVTYQPDKRVMFKIKHERTADCVLAGYRLHKSGGDVIGSLLLGLYQDDGQLASVGVIGA
FPMAERRRLFTELQELVTSFDDHPWNWAAHQSGERTPRKNEFSRWNAGKDLSFVPLRPER
VVEVRYDHMEGPRFRHTAQFNRWRPDRDPRSCTYAQLEQPLTFSLDDIVAGLGPRCGH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggacctaccagtcatgccgccgatttcgccgatgctggccaaggcggtcaagacgatc
ccggccgatgcgtcctatgaacccaaatgggatggattccgctccatctgttttcgcgac
aacgatgaggtagagctcggcagccgcaacgaacgtccgctgacccgttacttcccggag
ctggtcgcggcggtccgggcggagctgccgcggcgctgcgtccttgacggcgagatcgtg
atcgccaccggccacggcctggatttcgaggcgctgcaacagcgcatccaccccgccgat
tcccgggtgcggatgctcgccgagcacaccccggcatccttcatcgccttcgacctgctg
gccctcggcgacgacgactacacgacgcgtccatttgtggagcggcgcgcggcgctggtc
gaggcggtcggctccggcccatcgatccatgtcaccccggccaccaccgatcaggcgacg
gcacggcggtggttcgaagagttcgagggcgccggtctcgacggagtgatcgccaaaccg
ctggcggtcacctatcagccggacaagcgcgtgatgttcaagatcaagcacgagcgcacc
gccgactgcgtgctggccggatatcgcctccacaaatccggcggtgacgtcatcggttcg
ctattgctgggcctctaccaagacgacgggcaattggcgtcggtcggcgtgatcggggca
ttcccgatggccgaacgccggcggctcttcaccgagctgcaggagctggtgaccagcttc
gacgaccatccgtggaactgggccgcccaccagtccggcgaacgcacgccccgcaaaaac
gagttctcccgctggaacgccggcaaagacctctcgtttgtgccgctgcgccccgaacgc
gtggtcgaggtgcgctacgaccacatggagggcccgcggttccgtcacaccgcccagttc
aaccggtggcgtcccgaccgcgatccgcgttcctgcacctacgcccagctcgagcaaccg
ctgacgttcagtctcgacgacatcgttgctggtctcggaccccgctgcgggcactag

DBGET integrated database retrieval system