KEGG   Mycobacterium tuberculosis variant microti: RN08_0020Help
Entry
RN08_0020         CDS       T04291                                 

Definition
(GenBank) serine/threonine-protein kinase PknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmic  Mycobacterium tuberculosis variant microti
Brite
KEGG Orthology (KO) [BR:mmic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmic01001]
    RN08_0020
Enzymes [BR:mmic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RN08_0020
Protein kinases [BR:mmic01001]
 Serine/threonine kinases: Other
  Bacterial family
   RN08_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase RIO1 Kinase-like ABC1
Motif
Other DBs
NCBI-ProteinID: AMC57447
UniProt: A0A120IV10
LinkDB All DBs
Structure
PDB: 

Position
complement(17589..18758)
Genome map
AA seq 389 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRA
EARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPD
LPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPRGPARHPPWPGRPGGHSVGY
DSQGRGQLCWPDCGIPSIPPGHGWSPAAAAHVFVRSACAALGRGGAGGAGNHHRRAARHQ
SARGQQPAAGTDADRDHHREPSGQQHWRD
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcccccgagttggcgtgacgctgtcgggcagataccgcctgcagcgcctcatcgcc
accggtggtatgggccaagtctgggaggccgtggataaccggttgggccggcgtgttgcg
gtgaaggtgctcaagagcgagttctcctccgatccggagttcatcgaacggttccgggcc
gaagcgcgcaccaccgcgatgctgaaccatccgggcatcgccagcgtgcacgactacggc
gaaagccagatgaacggggagggtcgcacggcctacctggtgatggagctggtcaacggc
gagccactaaattcggtgctcaaacgcaccggccggctgtcgttgcggcacgcactggac
atgctcgagcagaccggccgcgctctgcagatcgcgcatgccgctggcctggtgcaccgc
gacgtcaaaccgggcaacatcttgatcacccccaccgggcaggtgaagatcaccgacttc
ggcatcgccaaagccgtcgatgcagcgcccgtgacccagaccggcatggtgatgggcacc
gcccaatacatcgcgccggagcaggccctcggtcacgacgccagcccggccagcgacgtc
tattcactgggagttgttgggtatgaagcggtttcgggtaaacggccgttcgccggcgat
ggtgccctgaccgtggcaatgaagcacatcaaggagcctccgccgccgctgcctcccgac
ctgccgcccaatgtgcgagaactcatcgagataactctggtgaagaaccccgcgatgcgc
tatcgcagtgggggaccgttcgccgacgcggtggcagcggtgcgcgccggccgccggccc
cgcggcccagccagacaccccccctggccgggccgccccggcggccattccgtcgggtac
gacagccagggtcgcggccaactctgctggccggactgcggcatcccgtcgatcccgccc
ggccacgggtggtcaccggccgccgcggcgcacgttttcgtccggtcagcgtgcgctgct
ctgggccgcgggggtgctgggggcgctggcaatcatcatcgccgtgctgctcgtcatcaa
agcgcccggggacaacagcccgcagcaggcaccgacgccgaccgtgaccaccaccgggaa
ccctccggccagcaacactggcgggactga

DBGET integrated database retrieval system