KEGG   Mycobacterium microti: RN08_3373Help
Entry
RN08_3373         CDS       T04291                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mmic  Mycobacterium microti
Pathway
mmic03030  DNA replication
mmic03410  Base excision repair
mmic03420  Nucleotide excision repair
mmic03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmic00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    RN08_3373
   03410 Base excision repair
    RN08_3373
   03420 Nucleotide excision repair
    RN08_3373
   03430 Mismatch repair
    RN08_3373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmic03032]
    RN08_3373
   03400 DNA repair and recombination proteins [BR:mmic03400]
    RN08_3373
Enzymes [BR:mmic01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RN08_3373
    6.5.1.6  DNA ligase (ATP or NAD+)
     RN08_3373
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     RN08_3373
DNA replication proteins [BR:mmic03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    RN08_3373
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     RN08_3373
DNA repair and recombination proteins [BR:mmic03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     RN08_3373
   NER (nucleotide excision repair)
    Other NER factors
     RN08_3373
   MMR (mismatch exicision repair)
    Other MMR factors
     RN08_3373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AMC60800
UniProt: A0A109SQX0
LinkDB All DBs
Position
3415239..3416732
Genome map
AA seq 497 aa AA seqDB search
MDVAATSSRLTKVARIAALLHRAAPDTQLVTIIVSWLSGELPQRHIGVGWAALRSLPPPA
PQPALTVTGVDATLSKIGTLSGKGSQAQRAALVAELFSAATEAEQTFLLRLLGGELRQGA
KGGIMADAVAQAAGLPAATVQRAAMLGGDLAAAAAAGLSGAALDTFTLRVGRPIGPMLAQ
TATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARLPEVVEATLAL
PVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFFDILHRDGTDL
LEAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMAKAPAARYLAG
RRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGGFVMVGKTFKGMTD
AMLDWQTTRFHEIAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGGLALRFARVVRYRA
DKDPAEADTIDAVRALY
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggccgccacctcgtcgcggctgaccaaggtcgcgcgcatcgccgccctgttg
caccgcgccgcgccagacacacagctggtcacgatcatcgtgtcgtggctctccggcgag
ctgccgcaacgccatatcggtgtcgggtgggcggcattgcggtccctaccgccgcccgcg
ccgcaaccggcgttgaccgtcaccggtgtcgacgccaccctctctaagatcggcactcta
tcgggcaaagggtctcaggcgcagcgcgcggcactcgttgcggaattgttctccgccgca
accgaagctgagcaaacctttttgttgcgactgctcggcggtgaactgcgccagggcgca
aagggcgggatcatggccgatgcggtcgcccaggccgccgggctcccggccgcgacggtc
caacgcgccgcgatgctaggcggcgacctggcggcagcggcggcggccggcctgtccggc
gcggcgctggacaccttcaccctgcgagtgggccgaccgataggcccgatgctggcacag
accgcgaccagcgtccatgatgcactcgaacgtcacggcggcacaaccattttcgaggct
aaactagacggcgcgcgagtgcagatccaccgggcaaacgaccaggtcaggatctacacc
cgaagcctggacgacgtcactgcccggctgcccgaggtggtggaggcaacactggcactg
ccggtccgggatctagtggccgacggcgaggcgatcgcgctgtgcccggacaaccggccg
cagcgtttccaggtcaccgcatcacggttcggccgatcggtcgatgttgcggctgcccgc
gcgacgcagccactttcggtgttcttcttcgacatcctgcatcgggatggtaccgacttg
ctcgaagcgccgaccaccgagcggctggccgccctggacgcactggtgccggctcggcac
cgcgtggaccggctgatcacgtccgatccaacggacgcggccaacttcctggatgcgacg
ctggccgccggccacgagggggtgatggccaaggcaccggccgctcgttaccttgcgggt
cgccgcggagcgggctggctgaaggtcaagccggtgcacacactcgacttggtggtgctc
gcggtggaatggggctcgggacgccggcgcggcaagctctccaatattcacctgggcgca
cgcgatccggctaccggtggattcgtgatggtgggcaagaccttcaaaggaatgaccgac
gccatgctggactggcagaccaccaggtttcacgagatcgcggtgggtccgacagacggc
tacgtcgtccaacttaggcccgagcaggtggtcgaggtagccctcgacggcgtgcaaagg
tcgtcgcgctacccgggcgggctggcattgcggtttgcccgcgtggtgcgctaccgcgcc
gacaaggacccggccgaggccgacaccatcgatgccgtgcgcgcgctctactga

DBGET integrated database retrieval system