KEGG   Mycobacterium tuberculosis variant microti: RN08_3663Help
Entry
RN08_3663         CDS       T04291                                 

Definition
(GenBank) ribonuclease VapC44
  KO
K07064  uncharacterized protein
Organism
mmic  Mycobacterium tuberculosis variant microti
Brite
KEGG Orthology (KO) [BR:mmic00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    RN08_3663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN DUF4411
Motif
Other DBs
NCBI-ProteinID: AMC61090
LinkDB All DBs
Position
complement(3698470..3698898)
Genome map
AA seq 142 aa AA seqDB search
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGCASCAITQNGFVRVISQPRYPSPIS
VAHAIDLLARATHTRYHEFWSCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFV
TFDQSIALTAVPGATKQHLATL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgctgttggacgtcaacgtgctactggcgctgttggaccgcgatcacgtcgac
cacgagcgcgcccgagcgtggatcaccgggcagatcgagcggggatgcgcttcctgtgcg
atcacccaaaacgggttcgtccgcgtcatcagccaaccgcgctatcccagcccaatctcg
gtagcccatgccatcgacttgttggctcgtgcgacgcacacgcgctatcacgagttctgg
tcctgcaccgtcagcattctcgactcaaaggtcatcgatcgttcccgcctgcacagcccc
aaacaggtcaccgacgcgtacttgctggccctcgcggtcgctcatgatggccgatttgtc
accttcgatcagtcgattgcgttgactgcggttcctggcgcaaccaaacagcacctggca
acgctgtag

DBGET integrated database retrieval system