KEGG   Methanobrevibacter millerae: sm9_0701Help
Entry
sm9_0701          CDS       T04203                                 

Definition
(GenBank) Hsp70 family protein with protein kinase domain
  KO
K04043  molecular chaperone DnaK
Organism
mmil  Methanobrevibacter millerae
Pathway
mmil03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmil00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    sm9_0701
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmil03019]
    sm9_0701
   03110 Chaperones and folding catalysts [BR:mmil03110]
    sm9_0701
   03029 Mitochondrial biogenesis [BR:mmil03029]
    sm9_0701
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmil04147]
    sm9_0701
Messenger RNA biogenesis [BR:mmil03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     sm9_0701
Chaperones and folding catalysts [BR:mmil03110]
 Heat shock proteins
  HSP70 / DNAK
   sm9_0701
Mitochondrial biogenesis [BR:mmil03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    sm9_0701
  Matrix
   MMC/PAM proteins
    sm9_0701
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    sm9_0701
Exosome [BR:mmil04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   sm9_0701
  Exosomal proteins of breast cancer cells
   sm9_0701
  Exosomal proteins of colorectal cancer cells
   sm9_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 Pkinase Pkinase_Tyr MreB_Mbl Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-ProteinID: ALT68498
UniProt: A0A0U2V1V9
LinkDB All DBs
Position
811578..815090
Genome map
AA seq 1170 aa AA seqDB search
MVEEFFNGQYEVKKFLGEGSFAEVYLVKHVFLDDLRAMKVIKQPLNENFDNKNVFNEVML
ATQLRHQNIISIYDAGIISQDSGINKAYFVMEYVPGGDLQQYLNSFINSNLSLSVHRCLN
LMKQILQGLNVLHSSNPVIVHRDLKLNNILLSYNECGDIVIKISDLGFAKEVSTEISDID
VAGTRPYMAPESFRKVISTATDIYAVGVIFYQLLTNNYPYDIEKFSLEEIIRGKPWNVSL
KAPSDYNDNVPKKLDEIVFKSLDSNPENRYQNASEFLDDIELIMTEFSDDKIPIIKEDYV
DENSEYIINENLKKAFKLAKCENRLNDAIEILEKEIIGNYDVRQCYGETLRMWKSKRPDL
KLISKAFSINLRGDNYVLSSNLLKEAIAYNPGMKNKYGHYLELWRIFIDLSKYGNLIKAV
MSLEELMDSNNEINEGYINIIDILKTFSIDVMVNESIRLVNLNNLDDGSKLMEFAIVCDS
RLKSKYAYKLSLWKQNMNLHFKTINDFNNCNTVDYAIDLGTVDSTVAYCNNGNPIIIKNY
KTGNEITPSAILIDEENNLKVGEIARTEIINNSKNAVSEFKGNMGFSIPFKFEKSSRVLF
PEELSAEVLKELRVSVFNQCRVNLEDVVICCPANSNPMKTKAINDAIDLAGFKSHNLILE
PIAVAFAYNLKSSHKDNGIWMIYDLGGGTFNVSLIEDNGDEIEKLATTGLDNLGGKTLDW
KVVEDIFIPKISMDLNLNDFNLNNSKYSEIFSKLKTAAEKSKKDLSISTKSNICINNLFD
NYDFIFTLTRDDFKEVICPLIKVTLDLCKNLLNEKDFSSKDIDKIILVGGSCLSPVVKDL
IKEEFDIPLEYSIDPLTVVAKGAAIYAGTIEKTIIETTVNEFSLILNKEKDIISGRAFAS
DNKFSFLGFDIEFLNQKTAESLKIPLNIDGEFMVKLKEGDYSINIYDSGDIVNIDEKSPN
QLISGEMLIPYFKHTFSLKYSEITYKKLFKQYIELLKQVNFLKENDSFNENDILEYIERM
FEIAQKDKRALNQVEIYLNYIKKTSSDLLNNLNFSNLLDNVINKINIAKRDSLFYVDDLK
DKLKLAVDDKDINILNDIHYQLIERYVLLNKNDVIKECFFNLIYDGIYSQYPDELIKRAI
AAINDSDYNLLSVLVNELYELDGRNSLLDK
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggtagaagaattttttaatggacagtatgaagtcaaaaaattcttgggagaaggatct
tttgcagaagtttacttggtcaaacatgtttttttagatgacttacgtgcaatgaaagta
attaaacagccattaaatgaaaattttgataataaaaatgtttttaatgaagtaatgctt
gcaactcagttaaggcatcaaaatattattagtatttatgatgcaggaataatttctcaa
gattctggaataaataaggcttattttgtaatggaatatgttcctgggggagatttacaa
cagtatcttaattctttcataaattcaaatctttcattgtcagttcatcgatgcttaaat
ttaatgaaacaaattcttcaaggattaaatgtattgcattcatcaaatccagttattgtt
catagggatttaaaattaaataatattttattgagttataacgaatgtggagatattgta
attaaaatctccgatttgggttttgcaaaagaagtaagtactgaaatttcagatattgat
gttgcaggtacacggccatatatggctccagagtcatttagaaaagttatttcaacagca
actgatatttatgcagtaggtgttattttttatcagttattaactaataattatccttat
gatattgagaaatttagtttggaagaaattattcggggaaagccttggaatgtttcttta
aaagctccgagtgactataatgataatgttcctaagaaattagatgaaattgtctttaaa
tctttagattcaaatcctgaaaataggtatcaaaatgcatcagaatttttagatgatatt
gaattaatcatgactgaattttcagatgataaaatcccaatcattaaagaggattatgtt
gatgaaaattctgaatatattattaatgaaaatcttaaaaaggcttttaagcttgcaaaa
tgtgaaaatagattaaatgatgctattgaaatattggaaaaggaaataattggaaattat
gatgttcgtcagtgttatggtgaaactttacggatgtggaaatctaagcgtcctgacctt
aaattaatttcaaaggcttttagtataaacttgaggggcgataattatgtgttatcgtct
aatcttttaaaagaagctattgcatataatcctgggatgaagaataaatatggtcattat
cttgaattgtggagaatattcattgatttgtcaaaatatggtaatttaataaaagcagta
atgtctcttgaggagctgatggattcaaataatgagattaatgaaggttatattaatatt
attgatatattgaaaacattttctatagatgtaatggtcaatgaatcgattcgtttagtg
aatttaaacaatcttgatgatggaagtaaattgatggagtttgcgattgtttgtgattca
aggttaaaatcaaaatatgcttataaactttcattatggaaacagaatatgaatttgcat
ttcaagacaataaatgattttaataattgcaatacggttgattatgcaattgatttaggt
actgttgattctacagtagcatattgtaataatggtaatccaataattataaaaaattat
aaaacaggtaatgaaattactccatcggctattttaattgatgaggagaataatcttaaa
gtaggagaaattgctagaactgaaataataaataattcaaaaaatgccgtatctgaattt
aaaggcaatatggggttttccattccatttaaatttgaaaaatcatcaagggttttgttt
ccagaagagctatctgcagaagttttaaaagaattaagagtatctgtttttaatcaatgt
cgtgtaaatcttgaagatgttgttatttgttgtcctgcaaattcgaatcctatgaaaaca
aaagcgattaatgatgctatagaccttgcgggttttaaatcacataatcttattttggag
ccaattgccgtagcttttgcatataatttaaaatcctcccataaagataatggaatatgg
atgatttatgatttaggtggtggtacatttaatgtatctcttattgaagacaacggggat
gaaattgaaaaacttgcaactactggtttagataatttgggtggaaaaacattagattgg
aaagttgtagaagatattttcataccaaaaattagtatggatttaaatttaaatgatttt
aatttgaataattccaaatattctgaaatattttcaaaacttaagactgctgcagaaaaa
tctaaaaaagatttgtctatttcaacaaaatccaatatatgtataaataatctttttgat
aattatgatttcatatttactttaactagggatgactttaaggaagtaatttgtcctttg
attaaagttacattagatttatgtaaaaacttattaaatgaaaaggatttttcaagcaag
gacattgataaaattattttggtggggggatcttgtttaagtcctgttgttaaggatttg
attaaagaagaatttgatattccacttgaatatagtattgacccattaacagttgttgca
aaaggtgcagctatttatgcaggcactatagagaaaactataattgaaactactgtaaat
gaattttcattgatattgaacaaagaaaaagatattatttcgggcagagcattcgcttca
gataataaattctcatttttaggatttgatatagaatttttaaatcaaaaaacggcggaa
tctttaaaaatacctttaaacattgatggggagtttatggtaaaattaaaagagggggat
tattcaataaatatttatgattctggtgatatcgtaaatattgatgaaaaatcacctaat
caattaatatctggtgaaatgttaattccatattttaaacatacttttagcttaaaatat
agtgaaataacctataagaaattatttaagcaatatattgaattattaaaacaggttaat
tttttaaaagaaaatgattcatttaatgaaaatgatattttggaatatattgaaaggatg
tttgaaatagctcaaaaagataaaagagcgcttaatcaagtagaaatttatttaaattat
atcaagaaaacatcttcggatttgttaaataatcttaatttttctaatcttttggataat
gtcattaataagataaatattgctaaaagagatagtttattttatgttgatgatttgaaa
gataaacttaaattggctgttgatgataaagatatcaatattttaaatgatattcattat
caattgattgaaagatatgttttgttaaataaaaacgatgtaattaaggaatgttttttt
aatttaatttatgatggtatatactcccaatatcctgatgaattaataaaaagggctatt
gctgctattaatgattcagattataatttattgagtgttttggtcaatgagttatatgaa
cttgatggtagaaattctctgttggataaataa

DBGET integrated database retrieval system