KEGG   Mycolicibacter minnesotensis: MMIN_04040
Entry
MMIN_04040        CDS       T06638                                 

Definition
(GenBank) hypothetical biphenyl dioxygenase beta subunit
  KO
K18252  phthalate 3,4-dioxygenase subunit beta [EC:1.14.12.-]
Organism
mmin  Mycolicibacter minnesotensis
Pathway
mmin00624  Polycyclic aromatic hydrocarbon degradation
mmin01100  Metabolic pathways
mmin01120  Microbial metabolism in diverse environments
mmin01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmin00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MMIN_04040
Enzymes [BR:mmin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     MMIN_04040
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: BBY32343
LinkDB
Position
390407..391033
AA seq 208 aa
MTSAQPSQRPGFPRPNSTHNPWELAVLGGAAPKHVRIGNPLPFSDARHLQAHQFLVDEAY
LLDAQHYTDWLDTLTDDIHYFMPVRVTTAAGAGFDTSPGMAHFDENKYSLSRRVARFQTE
HAWTEDPPSRLRHHITNVRTFACDDETHVIVESAELLFRSRGDVNEAALVSCGREDLLRL
TEHGWKLARRTIYVDESVLRMQNLAVFL
NT seq 627 nt   +upstreamnt  +downstreamnt
atgacatctgcgcaaccgagccagcgtccagggtttccccgaccgaactcaacacataac
ccctgggagctggcagtcctgggcggtgccgcgcccaagcacgtccgtatcggtaatccc
ctgcccttcagcgatgcccgccacctgcaggcacaccaattcctggtcgatgaggcctat
ctgctggacgcgcagcactacaccgactggctcgacacccttaccgacgacatccactac
ttcatgccggtgcgggtgaccaccgccgccggcgccggattcgacacctctccgggaatg
gcgcacttcgatgagaacaagtactccctgagccgacgggtggcccgttttcagaccgaa
cacgcgtggaccgaggatccgccctcacgcctgcggcatcacatcaccaacgtccgcacc
tttgcctgcgacgacgaaacgcacgtgatcgtcgagtcagcggaactgctgttccgcagc
cgcggcgacgtgaacgaggcggcactggtctcctgcggccgcgaagacctactccggctg
accgaacacggctggaagttggcgcgccgcaccatctatgtcgacgagtctgtcctgcgc
atgcagaacctggcggtattcctgtga

DBGET integrated database retrieval system