KEGG   Methanosarcina mazei S-6: MSMAS_0064Help
Entry
MSMAS_0064        CDS       T04532                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mmj  Methanosarcina mazei S-6
Pathway
mmj00630  Glyoxylate and dicarboxylate metabolism
mmj01100  Metabolic pathways
mmj01120  Microbial metabolism in diverse environments
mmj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSMAS_0064
Enzymes [BR:mmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSMAS_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB63260
UniProt: A0A0E3RF02
LinkDB All DBs
Position
80579..81865
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDIGYSPKETDLVCEFHIEPTAGVNFEEAATHLAGESSIDSWTEIATLSPELAEK
LKPHVFYADEGAQTIRVAYSEELFELGSVPQVLSAVAGNILSMKIVDNVRLQDIAFPKSM
INEFKGPNFGLPGIRKLVGVQDRPLIGTIVKPKVGLNSEKHAEVAYNSFVGGCDLVKDDE
NLSDQKFNSFEKRAELTLKLAEKAESETGEKKMYLCNVTAPTCREMIRRMNFLKDLGASY
VMVDIVPAGWTAIQTLREEAEDAGLALHAHRCMHSAYTRNPRHGISMLVVAKLCRLIGLD
QLHIGTVVGKMHGEKHEVLNLRDQCVLDKVPADESQHILAQDWGGLKPMFPVASGGLAPT
MIPDLYSIFGKDVIMQFGGGIHAHPMGTVAGATACRQALEASLEGISLQDYAKNHKELET
ALGKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagaagggactatattgacatcggctacagcccgaaagagacggatctggtctgtgaa
ttccacattgaaccaacagcaggagtgaattttgaagaagctgccacccatctggcaggg
gaaagttccatagattcctggactgagattgctacgctgagtcctgaacttgcagagaaa
ctgaaaccccatgtcttttatgcggatgagggtgcacagactataagggttgcttattcg
gaagagctttttgagctgggttctgtccctcaggtcctcagtgctgttgcagggaatatc
ctgagcatgaaaatagttgataacgtaaggctgcaggatatcgctttcccgaaatcaatg
attaatgaattcaaaggccctaacttcggactgccggggatcagaaaacttgtgggcgta
caggacaggcctctcatagggactattgttaaaccgaaagtcggcctgaactctgaaaag
cacgctgaggtcgcttacaattcttttgtcgggggctgcgaccttgttaaggacgatgaa
aatctgagtgatcagaaatttaacagttttgagaagagagccgagcttaccctgaaactt
gcagaaaaggcagagtctgagacaggggaaaagaagatgtacctctgcaatgtcactgcc
cccacctgcagggaaatgatccgccgcatgaacttccttaaagaccttggagccagttat
gtaatggttgacatcgtgcccgctggctggactgcgattcaaaccctgcgcgaggaagct
gaggatgcgggtcttgcccttcacgcccaccgctgcatgcattccgcctacacacgaaac
ccgcgccatgggataagcatgcttgttgttgccaagctgtgcaggctgataggccttgac
cagctccacataggcactgttgtcgggaaaatgcatggagaaaagcatgaagtccttaac
ctcagggaccagtgcgtgctcgataaagtgcctgccgacgaaagccagcatatccttgcc
caggactgggggggattaaagccaatgttccctgtagcatccggaggtctcgctcctaca
atgatccctgacctttattctatctttggaaaagacgttattatgcagttcggaggcgga
attcacgctcacccaatgggcacagtagccggagccactgcgtgcaggcaggctctcgaa
gcaagccttgaaggaatcagcctccaggactatgcgaaaaatcataaagaacttgaaacc
gctcttggaaaatggttgaagaaataa

DBGET integrated database retrieval system