KEGG   Methanosarcina mazei S-6: MSMAS_1474Help
Entry
MSMAS_1474        CDS       T04532                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, archaeal
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mmj  Methanosarcina mazei S-6
Pathway
mmj00620  Pyruvate metabolism
mmj00680  Methane metabolism
mmj00720  Carbon fixation pathways in prokaryotes
mmj01100  Metabolic pathways
mmj01120  Microbial metabolism in diverse environments
mmj01200  Carbon metabolism
Module
mmj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMAS_1474
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSMAS_1474
   00680 Methane metabolism
    MSMAS_1474
Enzymes [BR:mmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MSMAS_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKB64670
UniProt: A0A0E3RFT8
LinkDB All DBs
Position
1809474..1811054
Genome map
AA seq 526 aa AA seqDB search
MSKKATYPKVMCTQHPDSASKYISTQEEPGEAIEAAVVFGCDEYMPDYEGKATPYHQNVQ
IVSRFIEETDLIPGKDIFITPRAPSAAQENRFRQLMVMMSIAEANHGALEYSDVQAINEF
VHPMTGTVGEILDAQQHMVDVGELAKKEFGVAMEVPRIIPLIEDAPALLHAKELAENTLL
SWEKRFGAAPEKFRVFLGKSDSALSFGHVASTLSCKYAISGISEMDLELDTSTGIIFGAG
TLPFRGHLSLKNAENFFREYRGIGTITLQSALRYSHDKGEAEALVRLAEERLPESPEIYS
GEEKEEIVNLIGIFGARYNRIIREMSCTINQLAGLLPQQRDRLMHKGTGGYSRNVPDISG
LVCLCRKDVGKELSASMPAEDLNLPRAIKFTGALYSIGLPPEFIGTGTALEEAREKLGEE
SCERLLKKYFPSLASDLSFASGYLDLNVASRFLPEACLKEIRKDVEVLRDTFSLKVQPEP
SYRILLEMMQPDLLQAGTKGNCMDEEVSQLVCSTLTKMGKIRKALG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaagcaacctatccgaaagtaatgtgcacgcagcacccggactctgcatca
aaatatatctccacgcaggaagaacccggtgaagccattgaagctgcggtggtattcggc
tgtgacgaatatatgccggattatgaagggaaggcaactccttaccaccagaacgtccag
atagtatccagattcatagaagaaacggaccttatacccggaaaagacattttcattact
ccgcgtgctccgagcgcagctcaggaaaaccggttcaggcagcttatggtcatgatgtcc
attgccgaagccaaccacggagcccttgaatattcggatgtgcaggcaattaacgaattt
gttcacccaatgacaggcacggtaggggaaattcttgacgctcagcagcacatggtagat
gtgggcgaacttgcaaaaaaagaattcggtgttgcaatggaggtcccacgtataattccc
ctgatagaggatgctcctgccctgcttcatgcaaaagaacttgcagaaaacacactcctt
tcctgggaaaaacggtttggagctgcaccggaaaaattcagggtattcctgggcaaatcc
gattctgccctctctttcgggcacgtggcaagtacgctctcatgcaaatacgccataagc
gggatttccgaaatggacttagaacttgacaccagcacaggcatcatattcggagcaggg
actctgccttttagagggcacctgagcctgaaaaatgctgaaaactttttcagggaatat
cggggcatagggacaatcaccctccagtcagctctcaggtacagccacgataaaggagaa
gctgaagccctggtacgccttgcagaagagaggcttccggaatctccagaaatctattcc
ggcgaagaaaaagaagagattgtaaaccttataggaattttcggggcaaggtataaccgc
attatccgtgaaatgtcctgcaccataaaccagcttgcaggcctcctacctcagcagcgg
gaccgccttatgcataaagggacaggaggttattcgaggaatgttcccgatatttcaggc
ctggtatgcctctgccggaaggatgtcggaaaagagctcagcgcgagtatgcctgcagaa
gacctgaaccttccacgggctattaagttcacaggtgcgctttattctataggcctgcct
ccggagtttataggcacgggcacagcccttgaagaagccagggaaaagctgggagaagaa
tcctgtgaaaggctgcttaagaaatatttcccttcccttgccagtgacctgagctttgca
tccggctacctggacctcaatgtagcttcccgcttccttccagaagcctgcctgaaagaa
atccgcaaagacgttgaggtcttgcgcgacactttcagccttaaagtccagccagaaccc
tcgtaccgcatcctgctcgaaatgatgcagccagaccttttgcaggcaggaacgaaagga
aactgcatggatgaagaagtctcgcagcttgtatgttcaactctcaccaaaatgggaaaa
atcagaaaggctctgggttaa

DBGET integrated database retrieval system