KEGG   Methanosarcina mazei S-6: MSMAS_3222
Entry
MSMAS_3222        CDS       T04532                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mmj  Methanosarcina mazei S-6
Pathway
mmj00300  Lysine biosynthesis
mmj01100  Metabolic pathways
mmj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSMAS_3222
Enzymes [BR:mmj01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSMAS_3222
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AKB66418
UniProt: A0A0E3RML4
LinkDB
Position
3985322..3986116
AA seq 264 aa
MALLTPEDLENINKQLQEADSTVRRVTGLDIKGICKDFYGTTPCCEKVGIVPVTSGNGII
GSFSESLNAIAGYFGFDSFITDMPDVSGYYEAVKNGARIILMADDNTFLAHNLKNGKIAN
NQPCTGIIYAEIASRYLKADSKEVLAVGLGKVGFPGAAHLVQKGFKVYGYDADRTLLEKS
VSSLGIIPFNPVSPEGDRQRKFSIIFEATPCADTIPESVISENCVISTPGIPCAISKELQ
KKCGVELVMEPLGIGTASMLYSVL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccagaagacctggaaaatattaacaaacagcttcaagaagctgat
tctactgtccgcagagttacagggcttgatataaaaggtatctgtaaagatttctacggc
acaactccatgctgtgaaaaagtaggtatcgtgcctgtgacctcagggaacgggatcata
gggagcttttccgaatccctgaatgcaattgccgggtatttcgggtttgacagttttatt
actgatatgcctgacgtcagcggatattatgaggcagtaaagaacggagcccggatcata
cttatggcagatgataataccttccttgcccacaacctgaaaaatggaaaaatcgccaat
aaccagccgtgtacaggcataatttatgctgaaatagcttcaagatacctgaaagccgat
tccaaagaagtgcttgccgtgggtcttgggaaggttggatttccgggagcagcccatctc
gtacagaaaggcttcaaggtttacggatatgatgctgacagaacccttctagaaaaaagc
gtttccagcctcggaattatacctttcaatcccgtcagccccgaaggcgacaggcaaagg
aagttttccattattttcgaagcaaccccctgtgcagacacgattccggaatccgtaatt
tcggaaaactgtgtgatttctacccctgggataccctgtgcaatctcaaaggagctgcaa
aaaaagtgtggagttgaacttgtaatggaaccactggggataggtacagcatcaatgctg
tattctgtactctaa

DBGET integrated database retrieval system