KEGG   Morganella morganii: MU9_1088Help
Entry
MU9_1088          CDS       T02496                                 

Definition
(GenBank) hypothetical protein
Organism
mmk  Morganella morganii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMF_TATA_bd FUSC FKBP_C GAS KASH_CCD
Motif
Other DBs
NCBI-ProteinID: AGG30134
UniProt: M1S6G6
LinkDB All DBs
Position
1225463..1229008
Genome map
AA seq 1181 aa AA seqDB search
MRLNIRLCITVALFAAVQPATASEFNQVIEDFDRYIQAEKASGNFPVSVQQPGRSPETRV
TPPVNTAGKATQSQRQGTRKAARTGKRTVSSAQESRTQTAAAQKTDTTTPGISVPAQCEN
IVVREPVVVTNPVPIGYPQWSPAYLVRDSQKWGGNHRGFVFSPVPSRMTSSLTLTPEALF
AIPGEPFRSMTYFSDLPLTVARVLKPETWFTPSDPQKQLRLTRLKLQDVKRELASLNEKY
RNVQHNYEQALADIAKKETELSNLTLANNELQTAAKSDSAKLTAELEQNRKTIDSLNQQI
SENLARFGQAEGQVTALTAEKADLEKQIAALNKEKALADKNLALLESKNADMAKITQKLT
ELEKQLAQRDAEKQQLNDKILALTGENSKQSDALKKDLAALAAEKAALEKQITGLKSDNA
QAEKNLALLQDKNAGMAKITQKLTELEKQLAQRDAEKQRLTAKLQSQETENGKQSADLEK
RITALTADKSALEKQVAQLNSEKSRADENLALLGSKNADLAKLTQQLTATESKLKQSDTE
KLALTAQLAEQGSKSAKQSAELKKSLDGLTAEKAALEKQISALTADKNSASAKNTELLNA
KTAEMQKTTAQVSELEKQLKASTAEKQRIALELLQKTTDNQQQNAQLQKDLTALTADKTA
LTGQITRLTEEQAQAEKSIAQLSSKNADMEKMVQQLSTLEQQLKQRDTEKQALAAQIAAG
NADSDKQSAQLKKEFAALAADKTALEKQIAQLTAEKAQSEKNAALLNDKNADLAKVTRSL
TDTEQKLKNTETEKQKLADQLAVQNKDAAAQSDKLKKDLSTLAADKTALEKQITQLNAKN
TDNAKMAAQLQTLEKELQLREADKLKLTAQLQSREADNARQSDNLKKEVAALIVDKATLE
QKIAQLTADKQLLSAKISGADKESSTVQADNAGLNKKLAAEQQRAAQLDKALKEKTQQIE
ALAKSDAELIKLNTQLDNQKKQLADKDAELAKAAAKLKENADLSAKYTALQKEMDKQKAV
VSAQRTENTTLNTQIAKAEEKNKAVAAYTFQQVGELNKRKNQELIARLERQNYSKMTPDV
YYRITKQGQKYKALKGKTVTFAMHEELTDGKVTVSYPVNAPAVIPFNELPGDLAKFVSLA
GAGGAVDVYIKPEGGYGVAGIEGQIPPNSMSMIKLNVLKIE
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atgagactgaacatcaggttgtgtattactgtcgcattgtttgcggcagtgcaaccggca
actgcatctgaatttaatcaggttattgaagattttgaccgttatattcaggctgaaaaa
gcatcaggcaattttccggtatcagtgcagcaacctggcaggtctcccgaaacccgggtt
acaccgccggtaaatacggcgggtaaggccactcagtcacagcgtcagggcacacgtaaa
gctgcccgcacaggaaaacgcactgtttcgtccgcgcaggaaagccggacacaaacagct
gccgcacagaaaactgacacaacaaccccggggatctccgtaccggcacaatgcgaaaat
attgtggtcagggaaccggttgttgtgaccaatcctgttccgatcggatacccgcagtgg
tctccggcttatctggtccgtgacagccagaaatggggcggaaatcaccggggatttgtg
ttctcacctgttccttcccgtatgacctcctcactgactctcacaccggaagccttgttt
gccatcccgggtgaacctttccgttcaatgacgtatttctctgatctgccgctgacggtt
gcccgtgtgctgaaaccggaaacctggtttacgccgtctgatccgcagaaacaactgcgc
ctcacccgcctgaaattacaggatgtgaagcgtgaactcgcgtcactgaacgaaaagtac
cggaatgttcagcataattatgaacaggcgctcgcggatattgcgaaaaaagagacagag
ctcagcaatctgactctggcaaataatgagttacagactgcggcaaaaagcgacagcgcc
aaactgaccgccgagctggaacagaaccgcaaaacgattgattcactcaatcagcagata
agcgaaaacctggcccgttttggtcaggcggaaggtcaggtcacggctctgacagccgaa
aaagccgatcttgaaaaacagattgcggcgctgaataaagaaaaagcgctggcagataaa
aatctcgcgctgctggaaagcaaaaatgccgatatggcaaaaatcacgcagaagctgacg
gaactggaaaaacagctggctcagcgggatgcggaaaaacagcagctgaatgacaaaatc
ctcgcgctgaccggtgaaaacagcaaacagagcgacgcgctgaaaaaagacctggcagca
ctggcggcagaaaaagcggcactggaaaagcagattaccgggctgaaatccgataatgct
caggcagagaaaaatctcgcgctgttgcaggataaaaatgctggtatggcaaaaatcacg
cagaagctgacggagctggaaaaacagctggctcagcgggatgcggaaaaacagcgcctg
acagcaaaactgcaatctcaggaaaccgaaaacggcaaacaatcagccgatctggaaaaa
aggatcaccgcgctgacagcggataaatcggcgcttgaaaaacaggttgcgcagctgaat
tcagagaagagccgggctgacgagaacctcgcgctgctcggcagtaaaaatgccgacctc
gcaaaacttacgcaacagctgacggcaacagaaagtaagctgaaacaaagtgataccgaa
aaactggcactgaccgcacaactggcggaacagggcagtaaaagtgcgaaacagagcgcg
gagctgaaaaaatctctcgacggactgacggcagaaaaagcagctctggaaaaacagatc
tctgcactgaccgcagataaaaacagcgcctcagccaaaaataccgaactgctgaatgcg
aaaacagcggaaatgcagaaaaccaccgcgcaggtttcagagctggaaaaacagctgaaa
gcaagcacagcggaaaaacagcgtatcgcgcttgaattactgcagaaaaccaccgataac
cagcagcagaatgcgcagctgcaaaaagatctgaccgcactgaccgctgataaaacggcg
ctgaccgggcaaatcacccggctgaccgaagagcaggcacaggctgaaaaaagtatcgca
cagctgagcagtaaaaatgccgatatggaaaaaatggttcagcaactgagtacgctggag
cagcaactgaaacagcgtgataccgaaaaacaggcgctggcggcacagattgcggccggt
aatgctgacagtgacaaacagagcgcacagctgaaaaaagaattcgctgccctggctgcg
gataaaactgcgctggaaaaacagattgcacagctgacggcagagaaagcacagtcagag
aaaaatgcggcactgctgaatgataaaaatgccgatctggcgaaagtcacccgcagcctg
accgatactgagcagaagctgaaaaataccgaaacagaaaagcagaaacttgcagatcaa
ctggctgttcagaataaagatgcggcagcacagagtgacaagctgaaaaaagacctcagc
actctggccgccgataaaaccgcgctggaaaaacagattacacaactgaacgccaaaaat
accgataacgcaaaaatggcagctcagttgcagacactggaaaaagaattacagctgcgt
gaggccgataaacttaagctgacagctcagttacagagccgtgaggcggataatgcccgt
cagagcgataatctgaaaaaagaggtggctgcgctgatcgtggataaagccacactggaa
caaaaaattgcgcagctgacggcggataagcaactgctgtcggcaaaaatatctggtgca
gataaagagagcagtactgttcaggcggataatgccggactgaataaaaaattagcggca
gaacagcagcgggctgctcagctggataaagccttaaaagaaaaaacacagcagattgaa
gcactggcgaaatctgatgcggaattaattaagctgaatactcagcttgataaccagaaa
aagcagctggcagataaagatgcagaactcgccaaagcggcggctaagctgaaagaaaat
gccgatctctcggcaaaatacaccgcattgcagaaagaaatggataagcaaaaggcggtt
gtcagtgcacagcggacagaaaataccacgctgaatacacaaattgcgaaagcagaagaa
aaaaataaagccgtggcggcttatactttccagcaggttggtgagctgaataaacggaaa
aaccaggagctgatcgcccgcctggagcgccagaattattccaaaatgacgccggacgtt
tattaccgtatcaccaaacagggacagaaatataaagcgctgaaaggaaaaacagtcaca
tttgcgatgcatgaggaactaactgacggtaaagtaaccgtgtcatatccggtaaatgca
ccggcggttattccgttcaatgaattaccgggtgacctggctaaattcgtttcacttgcc
ggcgcaggcggtgcggttgatgtgtatataaaaccggaaggcggttatggtgtcgccggt
attgaagggcagataccaccgaactcaatgtctatgatcaaactgaacgtgctgaaaata
gaataa

DBGET integrated database retrieval system