KEGG   Morganella morganii: MU9_1137Help
Entry
MU9_1137          CDS       T02496                                 

Definition
(GenBank) Formate dehydrogenase O beta subunit
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
mmk  Morganella morganii
Pathway
mmk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MU9_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_2 Fer4 Fer4_21 Fer4_3 Fer4_16 Fer4_4 Fer4_17 Fer4_8 GP120 Fer4_18 Fer4_20 Fer4_13 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AGG30183
UniProt: J7U8J4
LinkDB All DBs
Position
complement(1285767..1286657)
Genome map
AA seq 296 aa AA seqDB search
MSMQSQDIIKRSATNSITPPPQARDDKFEVAKLIDVSTCIGCKACQVACSEWNDIRDEVG
FCTGVYDNPTDLSAKSWTVMRFSETKENGKLEWLIRKDGCMHCSDPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNIPRLNPKDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIHFGTKKDMLEVADERVQKLKKRGFANAGVYNPDGVGGTHVMYVLQHADNPELYHGL
PKDPQIDTPIDLWKGVLKPLSAIGFIATFAGLVFHYVGIGPNKETDDEEEEETHHE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgcaatctcaagacattatcaaacgttctgcgaccaacagcataacgccgcct
cctcaggcccgtgacgacaagtttgaagtcgccaagctgatcgatgtgtccacctgtatc
ggctgtaaagcctgtcaggtggcctgttccgaatggaatgacatccgtgatgaggtcggg
ttctgtaccggggtttatgataacccgactgatctcagcgccaaatcctggactgtcatg
cggttcagcgaaaccaaagagaacggcaaactggagtggctgatccgcaaggacggctgc
atgcactgttcggatccgggctgtctgaaagcctgtccgtctgccggtgcgattattcag
tatgccaatggtatcgttgatttccagtcagaacactgcatcggctgcggctactgtatt
gcgggttgcccgttcaatattccgcgtctgaatccgaaagataaccgggtgtacaaatgc
acactctgtgttgaccgggtcagcgtgggccaggagcctgcctgtgtgaaaacctgtccg
accggtgctatccatttcggtaccaaaaaagacatgctggaagtggcggacgagcgcgtg
caaaagctgaaaaaacgcggctttgccaatgccggggtctacaatccggacggtgtcggc
ggcacacacgtgatgtatgtgctgcagcacgcggacaatccggagctctatcacggactg
ccgaaagatccgcagattgatacaccgattgatctctggaaaggagtactgaaaccgctg
tcggctatcgggtttatcgccacctttgccggactggtattccactatgtggggatcggc
ccgaacaaagagacggacgatgaggaagaggaggaaactcaccatgagtaa

DBGET integrated database retrieval system