KEGG   Morganella morganii: MU9_314Help
Entry
MU9_314           CDS       T02496                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mmk  Morganella morganii
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmk03012]
    MU9_314
   03029 Mitochondrial biogenesis [BR:mmk03029]
    MU9_314
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmk04147]
    MU9_314
Translation factors [BR:mmk03012]
 Eukaryotic Type
  Elongation factors
   MU9_314
 Prokaryotic Type
   MU9_314
Mitochondrial biogenesis [BR:mmk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MU9_314
Exosome [BR:mmk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MU9_314
  Exosomal proteins of breast cancer cells
   MU9_314
  Exosomal proteins of colorectal cancer cells
   MU9_314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: AGG29360
UniProt: M1RG93
LinkDB All DBs
Position
complement(336664..337848)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GEPEWEAKIVELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMI
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVMG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacgaaaccgcacgttaacgttggtactatcggccac
gttgaccacggtaaaactaccctgactgctgcaatcaccaccgttctggcaaaaacctac
ggcggtaacgctcgtgcattcgaccagatcgataacgcgcctgaagaaaaagcacgtggt
atcaccatctctacttctcacgtagagtacgatactccgactcgccactacgcgcacgtt
gactgcccggggcacgccgactacgttaaaaacatgatcaccggtgctgcacagatggac
ggcgctatcctggttgttgctgcaactgatggccctatgccacagacccgtgagcacatc
ctgttaggtcgtcaggttggcgttccttacatcatcgtattcctgaacaaatgtgacatg
gttgatgatgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcag
tacgatttccctggcgacgacacgccaatcgttcgcggttcagcgctgaaagcactggaa
ggcgagccagagtgggaagctaaaatcgttgaactggcaggctacctggattcttacatc
cctgagccagagcgtgcaattgacaagccgttcctgctgccaatcgaagacgtattctca
atctccggccgtggtaccgttgttaccggtcgtgttgagcgcggtatcatcaaggttggt
gaggaagttgaaatcgtgggtatcaaagatactgcgaaaaccacctgtaccggtgttgaa
atgttccgcaaactgctggacgaaggccgtgcaggtgagaacgtcggtgttctgctgcgt
ggtaccaagcgtgaagaaatcgaacgtggtcaggttctggctaaaccaggttcaatcaaa
ccacataccaaatttgaatcagaagtttatattctgagcaaagatgaaggtggtcgtcat
actccattcttcaaaggctaccgtccacagttctacttccgtaccacagacgtaacaggt
actatcgaactgccggaaggcgttgaaatggtaatgccgggcgacaacatcaaaatgatc
gtcaccctgatccacccaatcgcaatggacgatggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggtgcgggtgttgtagcgaaagtgatgggttaa

DBGET integrated database retrieval system