KEGG   Morganella morganii: MU9_3426Help
Entry
MU9_3426          CDS       T02496                                 

Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mmk  Morganella morganii
Pathway
mmk00564  Glycerophospholipid metabolism
mmk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MU9_3426
Enzymes [BR:mmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MU9_3426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_oxidored Fer2_BFD FAD_binding_2 FAD_binding_3 DAO_C Pyr_redox_2 Thi4 HI0933_like NAD_binding_8 GIDA Pyr_redox_3 3HCDH_N TrkA_C
Motif
Other DBs
NCBI-ProteinID: AGG32470
UniProt: J7TQ31
LinkDB All DBs
Position
complement(3682489..3684135)
Genome map
AA seq 548 aa AA seqDB search
MSDSPVNEADVIIIGGGATGAGMARDCARRGLRTLLLERFDIATGATGRNHGLLHSGARY
AVTDPESARECISENRILRRIARHCVEETDGLFITLPEDEMAYQATFTEACRAAGIETQV
MSPQEALRFEPSVNPALLGAVKVPDGTVDPFRLTAANMLDAREYGAQVLTYHEVADVLRQ
GDQVTGVQVYDHQNHRRYPLYAPVVVNAAGIWSQRIAGFAGVHISMLPAKGSLLILGHRL
NQRVINRCRRPGDADILVPGDTISLIGTTSVHIPYDDIDNMIVTADEVDTLIREGSRLAP
AMAQARILRAYAGVRPLVAADDDPTGRSISRGIVLLDHEKRDGLRGFLTITGGKLMTYRL
MAEWATDAVCAKLGITAHCSTAEEPLPGSAHSAEQTLRKVISLPAPLRGSAVYRHGDRAA
ELPHTTRLDKSLVCECEAVTAGEVRYATESLTVNNLLDLRRRTRVGMGTCQGELCACRAA
ELLTQLKVTTAEKSETELMHFLNERWKGVRPVAWGNALRESEFTGWVYQGLCGLENSGTE
EQGEQHEI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattcacctgtcaatgaagcggatgtcattatcatcggcggtggcgcaaccggt
gccgggatggcgcgggactgtgcccggcgcggcctgcgcactctgttactggagcggttt
gatatcgcgaccggcgcgaccggccgtaaccacggcctgctgcacagtggtgcccgttat
gcggtgacggatccggaatccgcccgggagtgtatttcggaaaaccggatcctgcggcgc
attgcccgccactgtgttgaggaaacagacggcctgtttatcacactgccggaagatgag
atggcgtaccaggccacgtttaccgaggcctgccgcgcggcgggtattgagacacaggtg
atgtccccgcaggaggcgctgcgttttgagccgtctgtaaacccggcgctgctgggggcg
gtgaaagtgccggatggcaccgtggatccgttccgtctgactgccgccaatatgctggat
gcgcgggagtacggtgcgcaggtgctgacttatcacgaagtcgcggatgtactgcgtcag
ggcgatcaggtaaccggcgtgcaggtttatgatcatcagaatcaccgccgttatccgctg
tatgcgccggtggtggttaatgcggcagggatctggagccagcgtatcgccggttttgcc
ggggtgcatatcagtatgctgcccgccaaaggatcactgctgatcctcgggcaccgcctt
aaccagcgtgttattaaccgctgccgcagaccgggtgatgcggatatcctggtgccgggg
gataccatttccctgatcggcaccacttctgttcatattccttatgatgatatcgacaac
atgattgtcacggcggatgaggtcgataccctgatccgcgaaggctcacggctggcaccg
gcgatggcgcaggcgcgtattctgcgggcgtatgcgggtgttcgtccgctggtggcggcg
gatgacgacccgaccgggcgcagtatcagccgggggattgtgctgctggatcatgaaaaa
cgcgacggactgcgcggcttccttactatcaccggcggcaagctgatgacttaccggctg
atggcggagtgggcgacagacgcggtgtgcgcgaagctgggtataacggcgcactgttcc
acggcggaggagccgctgccgggctcggcgcattcggcggaacagacactgcgtaaagtg
atctcccttcctgccccgttacgcggatcggcggtgtaccgtcacggcgatcgcgcggca
gagttgccgcacaccacgcggctggataaaagcctggtctgtgagtgtgaagcggtcact
gccggtgaggtgcgctatgccacagaaagcctgacggtgaataacctgctggatctgcgc
cgccgtacccgtgtcggcatgggcacctgccagggcgagctgtgcgcctgccgtgcggcg
gagctgctgactcagctgaaagtcaccactgctgaaaaatccgaaaccgaactgatgcat
ttcctgaatgaacgctggaaaggtgtacgtccggtggcgtggggaaatgcgctgcgggag
agtgaatttaccggctgggtgtatcagggattatgcgggctggaaaacagcgggacagaa
gaacagggagagcagcatgaaatatga

DBGET integrated database retrieval system