KEGG   Morganella morganii: MU9_484Help
Entry
MU9_484           CDS       T02496                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mmk  Morganella morganii
Pathway
mmk00250  Alanine, aspartate and glutamate metabolism
mmk00410  beta-Alanine metabolism
mmk00430  Taurine and hypotaurine metabolism
mmk00650  Butanoate metabolism
mmk01100  Metabolic pathways
mmk01110  Biosynthesis of secondary metabolites
mmk01120  Microbial metabolism in diverse environments
mmk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MU9_484
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MU9_484
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MU9_484
   00430 Taurine and hypotaurine metabolism
    MU9_484
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MU9_484
Enzymes [BR:mmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MU9_484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGG29530
UniProt: J7U7I3
LinkDB All DBs
Position
539264..540646
Genome map
AA seq 460 aa AA seqDB search
MSLHAVKGKNSSEFIDIYASTDSDAKLPKYKMPDDSSDPRIIYSVVRDELLLDGNSRQNL
ATFCTTWVEDEVKQLMTDSVDKNMIDKDEYPQTAEIESRCVHIIADLWNSPQAQETIGCS
TTGSSEAAMLGGLAMKWRWRKNREKQGKETGKPNLVTGPVQVCWEKFARYFDVELRQIPL
EGDALGMQPSDLRKYCDENTIGVVATLGVTFTGIYEPVAELAKELDAIQRDTGLDIPLHV
DGASGGFIAPFIQPELVWDFRIERVKSINSSGHKYGLSPLGVGWVVWRSKEDLPEELVFN
VDYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGRAGYTKIQQACADTAQWLADELNKLGI
FDLVYDGRGALPAVAYKLKPGVTQFNLYDLSDRIRTRGWLIASYPLPADREKTVVQRIMI
RHGVSRDLAALLLDDIKRAIDHFRQNPVVNSTAKATFHHG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcatgcagtgaaaggtaaaaatagttcagaatttattgatatttacgcatca
acggactcggatgcaaaactccctaaatacaaaatgccggacgacagcagtgacccgcga
attatttacagcgtggtccgtgacgaattactgctggatggtaactcccgtcagaatctg
gcgacattttgtacaacatgggttgaggatgaagtcaaacagctgatgaccgacagtgtc
gataaaaacatgatcgacaaagacgaatatccgcaaactgcagaaattgaaagccgctgt
gtgcatattattgccgacctgtggaattccccgcaggcacaggaaactatcggctgctct
accaccggctccagtgaggcggcaatgctcggcgggctggcaatgaaatggcgctggcgt
aaaaaccgagaaaaacaggggaaagagaccggtaagccaaacctggtaaccggcccggta
caggtgtgctgggaaaaatttgcccgctattttgatgtggaactgcggcagatcccactg
gaaggtgatgccctcggtatgcagccgtctgacctgcgcaaatattgcgatgaaaacacc
atcggtgtggtggcgacactgggggtcacgtttaccgggatttatgaaccggtggcggaa
ctggcaaaagaacttgatgcaatacaacgggataccggccttgatattccgctgcatgtt
gatggtgccagcggcgggtttatcgcgccgtttatccagccggaactggtgtgggatttc
cggattgagcgggtgaaatccattaacagctccggacacaaatacggcctgtcaccgctg
ggtgtcggctgggtggtctggcgcagcaaagaagacctgccggaagagctggttttcaat
gtcgattatctcggcggcaatatgccgacatttgcactgaacttttcccgtcccggcggg
caaatcattgcacagtattataatttcctgcgtctgggacgcgccggttataccaaaatt
cagcaggcgtgtgcagatactgcgcaatggcttgcggatgaactgaacaagctggggatt
ttcgacctggtgtatgacggccgcggcgcactgccggcggtggcttacaagctgaaaccg
ggcgtgacacagttcaatctgtatgacctttccgaccgcatccgcacacgcggctggctg
atagcctcttatccgctcccggcggacagagagaaaaccgttgttcagcgcattatgatc
cgtcacggcgtcagccgcgacctggctgcactgctgctggatgatattaagcgggctatc
gatcacttcaggcaaaatccggtagtgaactcgactgccaaagccaccttccatcacggt
taa

DBGET integrated database retrieval system