KEGG   Morganella morganii: MU9_51Help
Entry
MU9_51            CDS       T02496                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mmk  Morganella morganii
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MU9_51
Enzymes [BR:mmk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MU9_51
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored DAO FAD_binding_3 K_oxygenase Thi4 NAD_binding_8 FAD_binding_2 AlaDh_PNT_C Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AGG29097
UniProt: J7TGI6
LinkDB All DBs
Position
49287..50861
Genome map
AA seq 524 aa AA seqDB search
MLDNTMKAQLKAYLEKLTRPVELVSTLDDSAKSGEIRTLLQEIAELSPKVTVREDNSASA
RKPSFLIVNPGQTQGIRFAGSPLGHEFTSLVLALLQVGGHPSKEAQELLDQVRNLEGEFH
FETYYSLSCHNCPDVVQALNLMAVLNPDITHTAIDGGLFQNEISERNIMGVPAVFLNGSE
FGQGRMTLAEIVNKVDSNAGKRAADALNQQAPYEVLIVGSGPAGASAAVYAARKGIRTGL
IGERFGGQVLDTVDIENYISVPKTEGAKLAAALKVHVEDYTADVIDNQSITALIPATEQG
GLHQLQTASGATLKARSVIISTGARWRNMGVPGEQEYRTKGVTYCPHCDGPLFKGKSVAV
IGGGNSGAEAAIDLAGVVEHVTLLEFAPELKADAVLQQKLRSLANVDIIVNAQTTEVLGD
GSKVTGLQYKDRVSGELHTLTLVGIFVQIGLLPNTQWLKGTLDLNPMGEIVVDARNETSI
KGVFGAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTSTRTAE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataacacaatgaaagcgcagcttaaagcgtatctcgaaaaattaacccgtccg
gttgagctggtatcaacccttgacgacagtgctaagtccggtgaaatcaggacattatta
caggaaatcgctgagttatcgccgaaggttaccgttcgcgaagataacagtgcttctgca
cgtaagccgtcattcctgattgtaaatccgggacagactcagggtatccgctttgcgggc
tccccgctgggtcatgaattcacctcactggtgttagcactgttacaagtcggcggtcat
ccgtcgaaagaagcacaggaattactggatcaggtgcgtaatctggaaggtgaattccat
tttgagacctactattcactgtcatgccataactgcccggatgtggtgcaggcactgaat
ctgatggcggtgcttaatccggatatcacacacacggccattgacggcggtctgtttcag
aatgagatctccgaacgcaatatcatgggcgtgccggcggttttcctgaatggcagcgag
ttcggtcagggccgtatgacactggcggaaatcgtcaataaagtcgacagcaatgccggt
aaacgtgcagccgatgcgctgaatcagcaggcgccgtatgaagtgctgattgtcggcagc
ggccctgccggggcatccgctgccgtgtatgccgcccgtaaagggatccgtaccggactt
atcggtgagcgtttcggcggccaggtgctggataccgtggatattgaaaactatatctcc
gtgccgaaaaccgaaggcgcaaaactggcggcggcactgaaagtgcatgtggaagattac
actgcagatgtgattgataaccagagcatcaccgcactgatcccggccacagaacaaggc
ggcctgcatcagttacagaccgcgtccggtgcgactctgaaagcgcgcagcgtcattatc
agtaccggtgcccgctggcgtaacatgggcgttccgggcgaacaggaataccgcaccaaa
ggggtaacttactgcccgcactgtgacggcccgctgttcaaagggaaatctgtggcggtg
atcggcggcggtaactccggcgcggaagcggctatcgacctggccggtgtggtggaacac
gtcaccctgctggaatttgccccggaactgaaagccgatgcggtgttacagcagaaatta
cgcagcctggcaaacgtggatatcattgtgaatgcacaaaccaccgaagtgctcggcgac
ggcagcaaagtgaccggtttacagtacaaagatcgcgtatccggtgagcttcacacactg
acactggtcgggattttcgttcagattggcctgctgccgaatacgcagtggctgaaagga
acactggatctgaacccgatgggtgagattgtggtcgatgcccgtaacgaaaccagcatt
aaaggggtgttcggtgccggtgactgtaccaccgtgccgtacaaacaaattattatcgcg
gcaggcgaaggggccaaagcatcactcagtgcctttgattacctgatccgcaccagtacc
agaaccgctgaatag

DBGET integrated database retrieval system