KEGG   Morganella morganii: MU9_720
Entry
MU9_720           CDS       T02496                                 

Definition
(GenBank) 5-methyltetrahydrofolate--homocysteine methyltransferase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
mmk  Morganella morganii
Pathway
mmk00270  Cysteine and methionine metabolism
mmk00450  Selenocompound metabolism
mmk00670  One carbon pool by folate
mmk01100  Metabolic pathways
mmk01110  Biosynthesis of secondary metabolites
mmk01230  Biosynthesis of amino acids
Module
mmk_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MU9_720
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MU9_720
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MU9_720
Enzymes [BR:mmk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     MU9_720
SSDB
Motif
Pfam: Met_synt_B12 S-methyl_trans Pterin_bind B12-binding_2 B12-binding MtrH
Other DBs
NCBI-ProteinID: AGG29766
UniProt: J7TWZ3
LinkDB
Position
798211..801891
AA seq 1226 aa
MDNKISVLKKALNQRILILDGAMGTMIQRYALNEKEYRGERFADWPVDLKGNNDLLSITQ
PDIIREIHHAYLGAGADIIETNSFNSTVISMADYQMESLSDEINEAAAKLARECADEWTR
KTPEKPRYVAGILGPTNRTASISPDVNDPAYRNVSYDALVEAYRSSVRALVRGGADIIMI
ETIFDTLNAKAAIYAVETEFEALGIKLPVMLSGTITDASGRTLTGQTTEAFYNSMRHIRP
ISFGLNCALGPAELRQYVAELSRIADCYVSTHPNAGLPNAFGGYDLDAANMAGYISEWAQ
SGLLNIVGGCCGTTPDHIRAIAQAVADIPPRVIPDRPVACRLAGLEPLTIDENSLFVNVG
ERTNITGSARFKRLIKEGNYQEALDIARNQVENGAQIIDINMDEGMLDSQAAMVRFLNMI
SGEPDIARVPIMIDSSKWEVIEAGLKCIQGKGIVNSISLKEGEAAFIDHAKKVLRYGAAV
IVMAFDETGQADTRQRKTEICQRAYRILTEQVGFPPEDIIFDPNIFAVATGIPEHNNYAV
DFIEACKDIKATLPHALISGGVSNVSFSFRGNDPVREAIHAVFLYYAIRNGMDMGIVNAG
QLAIYDDLPAALRDAVEDVILNRREDATDRLLALAEEYRGSKGENDQPQLAEWRGWDVEK
RLEYALVKGITEFIVEDTEAARLRADSPIEVIEGPLMNGMNVVGDLFSEGKMFLPQVVKS
ARVMKQAVAYLEPYIQAAKTSGSSAGKVLLATVKGDVHDIGKNIVGVVLQCNNYEIIDLG
VMVPCETILRTAIEEKVDIIGLSGLITPSLDEMVHVAKEMERQGFSLPLLIGGATTSKAH
TAVKIEPNYSGPVTYVQNASRTVGVVAALLSDKQRDEFVARTRKEYEVVRDQYARRQPRS
APVTLAQARANAFAADWDNYTPPRPAFTGVKTVTAPISVLRRYIDWTPFFMTWSLAGKYP
RILEDDVVGEEARRLFKEANAMLDELDRTGALTPRGVAGIFPANRIGDDIAVYRDESREE
VLLYSCHLRQQTQKKDDFPNACLADFVAPPGIPDYLGAFAVTGGLEEDTLAAQFDAAHDD
YNKIMVKALADRLAEGFAEYLHEQVRKTIWGYSPDENLDNDSLIRENYQGIRPAPGYPAC
PEHTEKSKIWELLDVERHTGMRLTESYAMWPGASVSGWYFSHPQSRYFAVAQIQRDQIED
YAARKGMPVKELERWLAPNLGYDPED
NT seq 3681 nt   +upstreamnt  +downstreamnt
atggataataaaatcagtgtattaaaaaaagcgcttaatcaacggatcctgattcttgat
ggtgcgatgggaacgatgatccagcgctatgcactgaacgaaaaggaataccgcggtgag
cgtttcgctgactggccggtggatctgaaaggaaataacgatctgttatccattacgcag
ccggatattatccgcgagatccatcacgcctatctgggagccggcgcggatattattgaa
accaacagttttaactccacggttatttccatggcggattatcagatggagtccctgtct
gatgaaatcaatgaagccgccgcgaaactggcgcgggaatgtgccgatgaatggacgcgc
aaaacgccggagaaaccccgctatgtggccgggattctgggtccgaccaaccggacggca
tcaatctctcccgatgtgaatgatccggcttaccgcaatgtatcctatgatgcgctggtt
gaggcttaccgcagctctgtgcgggcactggtccgcggcggggctgatatcattatgatc
gaaacaatcttcgataccctgaatgccaaggcggcgatttacgctgttgaaaccgagttt
gaggcgctggggattaaattgccggtgatgctttccggtacgatcactgatgcctccggc
cggacactgaccggtcagacaactgaagccttttataactccatgagacacatccgcccg
atctctttcgggctgaactgtgcgctggggcctgctgaactgcgccagtatgtggcggag
ctgtcccgtatcgcggattgttatgtcagtactcacccgaatgccggtctgccgaatgcg
ttcggcggttatgacctggatgccgccaatatggcgggctatatcagtgagtgggcacag
tccggtttgctgaatattgtcggtggctgctgcggcaccacgcctgaccatatccgtgca
atcgcgcaggcggtagcggatattccgccgcgtgttattcctgatcgccctgtggcctgc
cgtctggcggggctggagccgctgaccatcgatgagaattccctgttcgtcaacgtgggg
gagagaaccaatatcaccggctccgcacggtttaagcggctgattaaagaaggtaattac
caggaagcattggatattgcccgtaaccaggtggagaacggcgcacagattattgatatc
aacatggatgagggcatgctggattcacaggcggccatggtgcgtttcctgaatatgatt
tccggtgagccggatattgcccgcgtaccgattatgatcgactcctcaaaatgggaggtg
atcgaggccgggctgaaatgtatccagggtaaaggcattgtgaactcgatttccctgaaa
gagggagaggcagcctttatcgatcatgccaaaaaagtgctgcgttacggcgctgccgtg
attgtgatggcctttgatgaaaccggccaggcggatacccggcagcgcaagacagaaatt
tgtcagcgggcttaccgcattctgactgagcaggtgggattcccgccggaagatattatt
tttgacccgaatatttttgcggtggcaaccggtattcctgagcataacaattatgccgtt
gattttattgaagcctgtaaggatatcaaagcgacactgccccatgcactgatctccggc
ggggtctccaacgtctctttctcgttccgcggaaatgatccggtacgggaagcgattcac
gccgttttcctctattacgctatccgtaacggcatggatatggggattgtgaatgccggg
caactggccatttatgatgatttaccggctgcactgcgtgatgcggtggaagatgtgatc
ctgaaccgccgcgaggatgccactgaccggctgctggcgctggcagaagaatatcgcggc
agcaaaggggaaaatgatcagccgcagctcgcggaatggcgcgggtgggatgtggaaaag
cgtctggaatatgcactggtgaaagggatcacggaatttattgttgaggataccgaagcc
gcccgtctgcgggctgacagcccgattgaagtgatcgaaggcccgctgatgaacggcatg
aatgtggtcggtgatctgttcagtgagggaaaaatgtttctgccgcaggtggtgaaatcc
gcgcgggtgatgaaacaggcggtggcgtatctggaaccttatattcaggcagcgaaaacc
agcggctccagtgccgggaaagtcctgctggcgacagtcaaaggcgatgtgcatgatatc
ggcaagaatatcgtcggcgtggtattgcagtgtaataactatgaaattatcgatctcggg
gtgatggtgccctgtgaaacaattctccgcacggctattgaggaaaaagtcgatattatc
gggctgtccgggcttatcacgccgtcactggatgaaatggtacatgtagccaaagagatg
gagcgtcagggattttccctgccgctgctgatcggcggtgccaccacatccaaagctcat
acggcggtgaaaattgaaccgaattacagcggcccggtaacctatgtacagaatgcctca
cggacggtcggggtcgtggcggcgttattgtcagataaacaacgggatgagtttgttgcc
cgcacccgtaaagaatatgaggttgtccgcgaccagtatgcccgccgtcagccgcgctca
gcaccggtgacactcgcacaggcgcgggcaaatgcgtttgcggcggactgggataattat
acgccgccgcgcccggcatttaccggcgtgaaaaccgtcactgcaccgatttcggtactg
cgccgttatattgactggacacctttctttatgacctggtcactggccggaaaatacccg
cgtattctggaagatgatgtcgttggtgaagaagcccgccgcctgtttaaagaggcaaac
gcgatgctggatgagctggacagaaccggcgcactgacaccgcgtggcgtggcggggatt
ttcccggctaaccggatcggcgatgatattgcggtttaccgtgacgaatcccgcgaagag
gtgctgttatacagttgtcatctgcgccagcagacacagaagaaagatgatttcccgaat
gcctgcctggcggattttgtcgcaccaccgggaattccggattatctcggagcctttgct
gtcaccggcgggctggaggaggatacactggcagctcagtttgatgcggcacacgatgat
tacaataaaatcatggtgaaagccctcgctgaccggctggcggaagggtttgcggagtat
ctgcatgagcaggtgcgtaaaactatctggggctacagtccggatgaaaacctggataat
gactcgctgatccgcgaaaactaccaggggatccgccccgcacccggctacccggcctgt
ccggaacatacggagaaaagcaaaatctgggaactgctggatgttgaaagacataccggc
atgcggctgacggaatcttatgctatgtggccgggggcatcggtatccggctggtatttc
agtcatccgcagagccgctattttgcggtggctcagatccagagagatcagattgaggat
tatgccgcccgcaaaggtatgccggtgaaagagcttgagcgctggctggccccgaacctg
gggtatgatccggaagactga

DBGET integrated database retrieval system