KEGG   Morganella morganii: MU9_945Help
Entry
MU9_945           CDS       T02496                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mmk  Morganella morganii
Pathway
mmk00061  Fatty acid biosynthesis
mmk00780  Biotin metabolism
mmk01100  Metabolic pathways
mmk01212  Fatty acid metabolism
Module
mmk_M00083  Fatty acid biosynthesis, elongation
mmk_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MU9_945
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MU9_945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmk01004]
    MU9_945
Enzymes [BR:mmk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     MU9_945
Lipid biosynthesis proteins [BR:mmk01004]
 Fatty acid synthase
  Component type
   MU9_945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA PS-DH 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AGG29991
UniProt: J7TZU5
LinkDB All DBs
Position
1066293..1066745
Genome map
AA seq 150 aa AA seqDB search
MSDNHTLKIDEILELLPHRYPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPGKPIF
PGVLILEAMAQATGILAFKSLGKLEPGELYYFAAIDDCRFKRPVLPGDQMILEVTFHKER
RGVARFTGVAKVDGEVACEATMMCARRREG
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaaccatactctcaaaattgatgaaattttagagcttcttccgcaccggtat
ccgtttttattagtggatcgcgtgctggattttgaagaaggtaaatttttacgtgccgtg
aaaaacgtatcattcaatgagccgtttttccaggggcatttcccgggcaaaccaattttt
ccgggcgttcttattctggaagcgatggctcaggccaccggcattctggcgttcaaaagc
ctgggtaaattagagccgggcgaattgtattattttgccgccatcgatgactgtcgcttt
aaacgcccggtactgccgggagaccagatgatcctcgaagtgactttccataaggaacgc
cgcggcgttgcccgtttcacgggtgttgcgaaagttgacggagaagttgcctgcgaagct
accatgatgtgtgcacgccgccgtgaggggtaa

DBGET integrated database retrieval system