KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_1620Help
Entry
MLC_1620          CDS       T01478                                 

Gene name
xbaI_R
Definition
(GenBank) Restriction endonuclease BbaI
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI
Motif
Other DBs
NCBI-ProteinID: CBW53890
UniProt: F4MP58
LinkDB All DBs
Position
214700..215347
Genome map
AA seq 215 aa AA seqDB search
MLRMNAYDVIYKKIKEIANKYSNKLNSQFQKRVAEMQNDDKSHHLIYRVLGIPYDVGNEI
DYYQNQARFLYKYAGSFLEEVTILCFKEKYPFASKTKVKNTISNIPKTFEIDCLVNNNAY
EIKWRDATTDNDHIIKEHTRVKTLRSYNYKPIRIMFYYPNRVNSMRIQETLETLYKGVGG
EYYYGDSAWSYVKKTTGVDLLNILEKIAKERENND
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgtatgaatgcttatgatgttatttacaagaaaataaaagaaatagcaaataaa
tatagtaacaaacttaatagtcaatttcaaaaacgtgttgctgaaatgcaaaatgatgat
aaatctcaccatttaatctatagagttttaggaataccctatgatgttggaaatgaaatt
gattattatcaaaatcaagctcgttttttatataaatatgcaggctcttttttagaagaa
gtgacaattttatgttttaaagaaaaatatccatttgcttctaagacaaaagttaaaaat
acaatttctaatataccaaaaacttttgaaatcgattgtcttgtaaataataatgcttat
gaaattaaatgaagagatgctactactgataatgatcatataattaaagaacatactaga
gtaaaaacattaagatcttataattataaaccaattagaataatgttttattatccaaat
agagtcaattctatgagaattcaagaaacattagaaacattatataaaggtgtgggtggt
gagtattactatggtgattctgcttgaagttatgtaaaaaaaactacaggagtagatcta
ctaaatatacttgaaaaaattgcaaaagaaagggaaaataatgattaa

DBGET integrated database retrieval system