KEGG   Mycobacterium sp. MOTT36Y: W7S_01565Help
Entry
W7S_01565         CDS       T02113                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mmm  Mycobacterium sp. MOTT36Y
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFJ33298
UniProt: I2A7M4
LinkDB All DBs
Position
complement(324072..325142)
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVSPMLAKSVRAIPPHASYEPKWDGFRSICFRDGDDVELGSRNERPMTRYFPE
LVAAVRAELPERCVIDGEIVIATDHGLDFEALQQRIHPADSRVRMLAEATPASFIAFDLL
ALGGDDYTRRPFSERRAALVDAVGGSGRSIHVTPATTDLGTAQRWFDEFEGAGLDGVIAK
PLDVTYQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIG
AFPMAERRRLFAELQPLVTDFADHPWNWAAHEAGERTPRKNEYSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFSLGEIVPGLGPG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggacctccctgtcatgccgccggtgtcgccgatgctggccaagtcggttcgcgctatc
ccgccccacgcgtcgtacgagcccaagtgggacggattcaggtcgatctgtttccgtgac
ggcgacgacgtcgagctcggcagccgcaacgagcggccgatgacccgctactttccggag
ttggtcgccgcggtcagggccgagctgccggagcgctgcgtgatcgacggggagatcgtc
atcgccaccgaccacggcctggacttcgaggcgctgcagcaacgcattcacccggccgac
tcgcgggtgcgaatgctcgccgaggcgacgcccgcgtccttcatcgcgttcgacctgctg
gcgctcggcggcgacgactacacccggcggccgttcagtgagcggcgggcggccctcgtc
gatgcggtgggcggatcgggtcgctcgatccatgtcacgccggcgacgaccgatctgggc
accgcgcagcgatggttcgacgagttcgagggcgccggcctcgatggcgtgatcgccaag
cccctggacgtcacctaccagccggacaagcgggtgatgttcaagatcaagcacgaacgg
accgcggactgtgtggtcgccggctatcgggtccacaagtccggcgccgacgcgatcggg
tcgctgctgctggggctctaccaggacgacgggcagctggcctcggtcggcgtcatcggc
gccttcccgatggccgagcggcgccgcctgttcgccgaactgcagccgctcgtcaccgac
ttcgcggaccatccgtggaactgggccgcccacgaggccggcgagcgaacgccccgcaaa
aacgaatactcgcggtggaacgccggcaaggacctctcgttcgtgccgctgcggcccgag
cgcgtggtcgaggtccgctacgaccacatggagggtcggcgctttcgtcataccgcgcag
ttcaatcggtggcgtccggaccgcgacccgcgctcgtgcacctacgaacagctggaacag
ccggtgacgttcagcctcggcgagatcgtgccgggcctcggcccgggctga

DBGET integrated database retrieval system