KEGG   Mycobacterium sp. MOTT36Y: W7S_07225Help
Entry
W7S_07225         CDS       T02113                                 

Definition
(GenBank) hypothetical protein
Organism
mmm  Mycobacterium sp. MOTT36Y
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFJ34424
UniProt: I2AAV0
LinkDB All DBs
Position
complement(1505384..1506850)
Genome map
AA seq 488 aa AA seqDB search
MTKNSDHRCYDEVFIGGQWRKPANPQQLEVISPHSEEPVGHVQAAGPEDVDAAVVAARHA
FDHGPWPRMSHADRMAKVEQLAAIYARHSDDMADLITDEMGSPRSFSRMGQGVAAASLIH
LALAAARDFPWTERRQGVLGEVHLRRAPVGVVGAIVPWNVPQFLIMPKLIPALIAGCTVI
VKPAPETPLDALWLAEMIEQLDLPEGVVSVLPGGTDVGEALVRHPGVDKIAFTGSSAVGR
RIAALCGEQLKRVSLELGGKSAAIILDDADIDKTVAGLKSAGLMNNGQACVAQTRILVSD
RKHDEVVDALAGMMSALHVGDPADEATDIGPLVAQRQQRRVQDYIQSGRREGARVVLGGE
QSPSERGWYVQPTLFADATNDMRIAREEIFGPVLTVLRYRDEDDAIRIANETDYGLAGSV
WTSDIGHGLDVAAAVRTGTYGINMYTLDIGAPFGGFKQSGIGREFGPEGLHEYVELQTLI
CKGQLPPL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaattccgaccatcgttgttacgacgaagtgttcatcggagggcagtggcgc
aagcccgccaatccccaacagctcgaagtgatctcgccgcactccgaggagccggtcggt
cacgtccaggcggccggccccgaggacgtcgacgccgccgttgtcgccgctcggcacgcc
ttcgaccacggaccgtggccgcggatgagccacgccgatcggatggccaaagtcgaacag
ctcgccgcgatctacgcccgccacagcgacgacatggccgacctgatcaccgacgagatg
ggatcaccgcgcagtttcagccggatgggccagggggtggccgccgcgtcgctgatccac
ctcgcgctggccgccgcccgcgactttccgtggaccgaacgccgccagggcgtgctcggc
gaagtgcacctgcgccgggccccggttggggtggtgggcgcgatcgtgccctggaacgtg
ccccagtttttgatcatgcccaagctgatccccgcgctcatcgcggggtgcacggtgatc
gtcaagcccgcacccgaaacgcctttggacgctttgtggttggccgagatgatcgagcag
cttgacctgcccgagggcgtggtctcggtgctgcccggcggcaccgacgtcggcgaggcg
ctggtgcgccaccccggcgtggacaagatcgcgttcaccgggtccagcgccgtcgggcgc
cggatcgccgcgctgtgcggggaacaactgaaacgcgtgagcctggagctgggcggcaaa
tcggcggcgatcatcctcgacgacgccgacatcgacaagaccgtggccgggttgaagagc
gcgggcctgatgaacaatggccaggcctgcgtcgcccagacccgcatcctggtcagcgac
cgcaagcacgacgaggtcgtcgacgccctggccggcatgatgtcagcgctgcacgtcggt
gacccggccgatgaggcaacggacatcggaccgcttgtcgcccaacgccaacagcgccgc
gtccaggactacatccagtccggccgccgcgaaggggcccgcgtcgtcctgggtggcgaa
cagagcccgtccgagcgcggctggtacgtgcagccgacgctgttcgccgacgccaccaat
gacatgcgcatcgcccgggaggagattttcgggccggtgctcacggtgctgcgctaccgg
gacgaggacgacgcgatccgcatcgccaacgaaaccgactacggtctggccggttcggtg
tggacgtccgacatcgggcacggcctcgacgtcgcggccgccgtccgcacggggacctac
ggcatcaacatgtacaccctcgacatcggggcaccgttcggcggtttcaagcaatccggc
atcgggcgcgagttcggccccgagggtctgcacgagtatgtcgaactgcagacgctgata
tgcaaagggcagttgccacccctatga

DBGET integrated database retrieval system