KEGG   Mycobacterium sp. MOTT36Y: W7S_10760Help
Entry
W7S_10760         CDS       T02113                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01130  Biosynthesis of antibiotics
mmm01230  Biosynthesis of amino acids
mmm02024  Quorum sensing
Module
mmm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    W7S_10760
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    W7S_10760
Enzymes [BR:mmm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     W7S_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AFJ35123
UniProt: I2ACU9
LinkDB All DBs
Position
2324153..2325541
Genome map
AA seq 462 aa AA seqDB search
MNWTVDIPIDQLPPLPPLPTDLRARLDAALAKPAAQQPSWPADQASAMRTVLESVPPVTV
PMEIVRLQEQLAQVARGEAFLLQGGDCAETFTENTEPHIRGNVRTLLQMAVVLTYGSSMP
VVKVARIAGQYAKPRSADIDALGLKSYRGDMINGFAPDAAVREHDPSRLVRAYANASAAM
NLVRALTSSGLASLHLVHDWNREFVRTSPAGARYTALATEIDRGLRFMSACGVADRNLQT
AEIYASHEALVLDYERSMLRLSENDSGEPQLYDLSAHTVWIGERTRQLDGAHIAFAEVIA
NPIGVKIGPTITPELAVEYVERLDPHNKPGRLTLVSRMGNNKVRDLLPPIVEKVQATGHQ
VIWQCDPMHGNTHESSNGYKTRHFDRIVDEVQGFFEVHRALGTHPGGIHVEITGENVTEC
LGGAQDISDTDLVGRYETACDPRLNTQQSLELAFLVAEMLRD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaccgtcgacatcccgatcgaccagctgccgccgctgccgccgctgccgacc
gatctgcgggcgcgattggacgccgcgctggccaagccggccgcccagcaacccagctgg
cccgccgatcaggcgtcggcgatgcgcacggtcctcgagagcgtgccgccggtcacggtg
ccgatggagatcgtgcggctacaggagcagctcgcccaggtggccaggggtgaggcgttc
ctgctgcagggcggtgactgcgcggagacgttcaccgagaacaccgaaccccacatccgc
ggcaacgtgcgcaccctgctgcagatggcggtggtgctgacctacggctcgagcatgccg
gtggtcaaggtggcccgcatcgcggggcagtacgccaaaccgcgatcggccgacatcgac
gcgctggggttgaagtcctaccgcggcgacatgatcaacggcttcgccccggacgccgcg
gtgcgcgagcatgatccgtcgcgattggtgcgcgcctacgccaatgccagcgcggcgatg
aatctggttcgtgcgctgacgtcgtcggggttggcgtcgctgcatctggtccacgactgg
aaccgcgagttcgtccggacctcgccggcgggcgcccgctacacggcgctggccaccgag
atcgatcgcggcctgcgcttcatgagcgcgtgcggggtggccgaccgcaacctgcagacc
gccgaaatctacgccagccacgaggctttggtgctcgactacgagcggtcgatgctgcgg
ctgtccgagaacgacagcggcgagccccagctgtacgacctgtcggcgcacaccgtgtgg
atcggcgagcggacccgccagctcgacggggcgcacatcgccttcgcggaggtgatcgcc
aacccgatcggcgtcaagatcggcccgacgatcaccccggagttggccgtcgaatacgtc
gagcggctcgacccgcacaacaagcccggccggctgacactggtgagcaggatgggcaac
aacaaggtgcgcgatctgctgcccccgatcgtggagaaggtccaggccaccggtcaccag
gtgatctggcagtgcgacccgatgcacggcaacacccacgagtcgtccaacgggtacaag
acccgccacttcgaccgcatcgtcgacgaggtgcagggcttcttcgaggtgcaccgcgcg
ctgggcacccatcccggcggcatccacgtcgagatcaccggggagaacgtcaccgagtgt
cttggtggggcgcaagacatttcggacaccgacctggtcggccgctacgagaccgcgtgc
gacccacggctgaacacccaacagtcgctggagttggccttcctggtcgccgagatgctg
cgcgactga

DBGET integrated database retrieval system