KEGG   Mycobacterium sp. MOTT36Y: W7S_16555Help
Entry
W7S_16555         CDS       T02113                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00250  Alanine, aspartate and glutamate metabolism
mmm00280  Valine, leucine and isoleucine degradation
mmm00310  Lysine degradation
mmm00410  beta-Alanine metabolism
mmm00640  Propanoate metabolism
mmm00650  Butanoate metabolism
mmm01100  Metabolic pathways
mmm01120  Microbial metabolism in diverse environments
Module
mmm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    W7S_16555
   00650 Butanoate metabolism
    W7S_16555
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    W7S_16555
   00280 Valine, leucine and isoleucine degradation
    W7S_16555
   00310 Lysine degradation
    W7S_16555
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    W7S_16555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmm01007]
    W7S_16555
Enzymes [BR:mmm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     W7S_16555
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     W7S_16555
    2.6.1.48  5-aminovalerate transaminase
     W7S_16555
Amino acid related enzymes [BR:mmm01007]
 Aminotransferase (transaminase)
  Class III
   W7S_16555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFJ36272
UniProt: I2AG48
LinkDB All DBs
Position
3704879..3706219
Genome map
AA seq 446 aa AA seqDB search
MAGLEQTRQLVTEIPGPLSLELSKRRAAAVSHAVNVSVPVFVARAGGGIIEDVDGNRLID
LGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGSGEKRS
VLFNSGAEAVENAVKVARAYTRKSAVVAFNHAYHGRTNLTMALTAKSMPYKAGFGPFAPE
VYRAPLSYPYRDGLIDKELATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIVP
AEGFLPTLLEWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPLS
AVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERAQQLERLITEPLLR
LQAGDDRIGDVRGRGAMIAIELVKSGTAEPDKELTQKLTVAAQAAGVIVLTCGMFGNIIR
LLPPLTIGDELLAEGIDILSGLLRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtggccggcctcgagcagactcgccaactggtcaccgagatccccggcccgctctcgctg
gaactgagcaagcgccgggcggcggcggtgtcgcacgcggtcaacgtctccgtcccggtc
ttcgtggcgcgcgccggcggcggcatcatcgaggacgtcgacggcaacaggctcatcgac
ctcggctccggcatcgcggtgacgaccatcggcaactcggcgccccgggtggtcgacgcc
gtgcgcgcgcaggtcgccgagttcacccacacctgcttcatggtgacgccgtacgagtcg
tacgtcgctgtcgccgagacgctcaaccggatcaccccgggctccggcgagaagcgctcg
gtgctgttcaattccggcgccgaggccgtcgagaacgccgtcaaggtcgcgcgggcctac
acgcgcaagtccgcggtggtggcgttcaaccacgcctaccacggccggaccaacctgacg
atggcgctgaccgcgaagtccatgccctacaaggccggcttcggcccgttcgcgccggag
gtctaccgggcgccgctgtcctacccctatcgggacggcctgatcgacaaggagctggcc
accgacggggagaaggccgccgcgcgggccatccgggtcatcgacagccagatcggcgcc
gacaacctggccgccctcctgatcgagccgatccagggcgaaggcgggttcatcgtgccg
gccgagggattcctgcccaccctgctggagtggtgccgcaggaacgacgtggtgttcatc
gccgacgaggtgcagaccggtttcgcgcgctcgggcgccatgttcgcctgcgaacacgag
ggcatcgagcccgacctgatctgcaccgccaaggcgatcgccgacgggcttcccctgtcg
gcggtcaccggccgggccaacatcatggacgcgccgcacgtcggcggcctcgggggcacc
ttcggaggcaaccccctggcctgcgcggcggccttggccacgatcgagacgatcgagagc
gacgggctggtcgagcgggcccagcagctggagcggctgatcaccgaaccgctgctgcgg
ttgcaggccggcgacgaccggatcggcgacgtccgtgggcgcggcgcgatgatcgcgatc
gagttggtgaagtcggggaccgccgagcccgacaaggagctgacccagaagctgaccgtc
gccgcccaggcggccggcgtcatcgtcctgacctgcggcatgttcggcaacatcatccgg
ctgctgccgccgctgaccatcggcgacgagctgctggccgagggaatcgacatcttgagc
gggttgttgcgcgacctgtaa

DBGET integrated database retrieval system