KEGG   Candidatus Midichloria mitochondrii: midi_01247
Entry
midi_01247        CDS       T01561                                 

Definition
(GenBank) Transglycosylase-putative
Organism
mmn  Candidatus Midichloria mitochondrii
SSDB
Motif
Pfam: SLT Amidase_6
Other DBs
NCBI-ProteinID: AEI89518
UniProt: F7XUF9
LinkDB
Position
complement(1170017..1170706)
AA seq 229 aa
MYLFRLLLVLLSINLTINKAAAAESDYLHCTKAINFYEERYKLPRNLLHSIATVESGKWN
EKHKRILPWPWTLNVAGKAHYFATKQEAVNFLKSVLAKGIEQVDVGCAQINWYYHGKKHF
KKPEHAFNPVFNTAYAAYFLSQNYERTKDWAKAVAIYHSRTEEKGKNYAAKVHKIWHNHR
LGSKVGFDRKQKIEPKTYHRVIISRNLNNLDSDIIVRTSAKDSSVTMLP
NT seq 690 nt   +upstreamnt  +downstreamnt
atgtacttatttagattgttattagttttactttctataaatcttacaataaataaagcg
gctgctgcagaaagcgattatcttcattgtactaaagctatcaatttttatgaagagaga
tataagctgccgcgtaatttgttgcattcaattgcaactgttgagtccggtaaatggaat
gagaagcataagaggatattgccgtggccttggactttaaatgtggcggggaaggcacat
tattttgctactaaacaagaagcagtaaattttttgaaatctgtcttggcaaaaggtata
gaacaagttgacgttgggtgcgctcagattaattggtattatcacggtaaaaaacacttc
aaaaaaccagaacacgcttttaatccagtttttaatactgcctatgcagcttatttctta
tcgcaaaattatgagcgcactaaggattgggctaaagctgttgctatataccattcacgc
accgaggagaaggggaaaaactatgcagcaaaagtgcataagatatggcataatcaccgc
ttagggtcaaaagttggctttgatcgcaaacaaaagatcgagccaaaaacttatcacagg
gtcataatcagcagaaatttgaataacttggatagcgatatcatagtgcgtacaagcgca
aaggacagcagtgttactatgttgccttag

DBGET integrated database retrieval system