KEGG   Methanococcus maripaludis S2: MMP0230Help
Entry
MMP0230           CDS       T00164                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00790  Folate biosynthesis
mmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MMP0230
Enzymes [BR:mmp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     MMP0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2 HD_2
Motif
Other DBs
NCBI-ProteinID: CAF29786
UniProt: Q6M0P0
LinkDB All DBs
Position
complement(238779..239465)
Genome map
AA seq 228 aa AA seqDB search
MKDLIALAEEIKDEKLRKKVIEYINNPLPKHPEIESTGITIENSPASVKRHHKYPGGLLE
HTIAVTKMAVKMAEALEETYGIELNRDLLISGGILHDLMKPQNYQLKDGKFDHLSDFHLD
HLTLGIAELYRRDFPLEVIKVVASHHGDHGPVSPDSIEAWLIHHADNVDAAINDIGIRIC
QARAREFGIDDSQIYKIVNPLKLYEMRKKLGKDKVKEFLKEKLEIKDE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatctaatcgctcttgcagaggaaattaaggacgaaaaattaagaaaaaaagtt
attgaatatataaataatcccctaccaaaacatcctgaaattgaaagtactggaataaca
attgaaaactcccctgcgagcgttaaacggcatcataaataccccggaggactcctcgaa
catacaattgcggttacaaaaatggctgtaaaaatggcagaagctttggaagaaacatat
ggtattgaactaaaccgtgatttactaatttctggaggaatactccacgatcttatgaaa
ccgcaaaattatcagttaaaagatggaaaattcgaccatctttcagattttcaccttgat
catttaacactcggaattgcagaactttacaggagagattttccactcgaagttataaaa
gttgtagcaagccaccacggagaccacggacccgtaagtccagattcaattgaagcgtgg
ctaattcatcatgcagacaacgtagatgcggccattaatgatataggaattagaatatgt
caggcaagagcaagagagtttggaattgatgattcacaaatttataaaatagtcaacccg
ttaaaactctatgaaatgcgtaaaaaattaggaaaagataaagtaaaagaatttttaaag
gaaaaattagaaataaaggacgaataa

DBGET integrated database retrieval system