KEGG   Methanococcus maripaludis S2: MMP1270Help
Entry
MMP1270           CDS       T00164                                 

Definition
(GenBank) Orotidine 5'-phosphate decarboxylase
  KO
K13831  3-hexulose-6-phosphate synthase / 6-phospho-3-hexuloisomerase [EC:4.1.2.43 5.3.1.27]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00030  Pentose phosphate pathway
mmp00680  Methane metabolism
mmp01100  Metabolic pathways
mmp01120  Microbial metabolism in diverse environments
mmp01200  Carbon metabolism
mmp01230  Biosynthesis of amino acids
Module
mmp_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MMP1270
  09102 Energy metabolism
   00680 Methane metabolism
    MMP1270
Enzymes [BR:mmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     MMP1270
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     MMP1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like OMPdecase PcrB Ribul_P_3_epim Aldolase QRPTase_C PEP_mutase IMPDH
Motif
Other DBs
NCBI-ProteinID: CAF30826
UniProt: Q6LXS8
LinkDB All DBs
Position
complement(1253911..1255227)
Genome map
AA seq 438 aa AA seqDB search
MQFKSELPPVQVALDLVDLPRAINIAKEAVLGGATWVEAGTPLIKSEGMNAIRELRKNFP
TLTIVADMKTMDAGSTEVEMAAKAGANVILILGVGPDSMIKDAVKAGKKYGVLVGTDLIA
TEDPVKRAVELEEMGVDIINIHVGLDQQVLNVDPVELVKRVSENCKKAKIAAAGGLNSET
AVKAYEAGADIIIAGGTLYKSADPEQTARDIVKSLETGKPVKTDKFKKFNEDELGSAFDI
VSTSNISDAMHRTGEMKGLKPVWNSERPLKFAGPAVTVRTYSGDWSKPVSAIDNCEAGNV
LVIDNCSSEIACWGGLATLSCKTKGVVAVVIDGAVRDVEEILKIGIPVYARSITPTAGEP
KGFGEINAVIECAGRTVEPGDWIVGDENGIIVVPKNEAMEIANRAIDVKEREDRVKEEIT
RGTTLAKTIRLKDWELKK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttaaatcagaattacctcctgtgcaggtagctcttgatcttgttgatcttcca
agggcaataaatattgcaaaagaagcagttttaggtggtgctacatgggttgaggcagga
actccattaataaaatctgaaggaatgaatgcaattcgagaacttagaaaaaacttccca
actcttacaatcgttgcagacatgaaaacaatggatgcaggaagtactgaagttgaaatg
gcggcaaaagcaggtgcgaatgttattttaattttaggtgttggtccggattcaatgata
aaagatgctgtaaaagcaggaaaaaaatacggcgtgttagttggaactgatttaattgca
acggaagatcctgtaaaaagagcagttgaactcgaagaaatgggtgtagatattataaat
atccacgtaggactcgaccaacaggttttaaatgtggatcctgttgaacttgtaaaaaga
gtttctgaaaactgtaaaaaagcaaaaattgcagcagcaggtggtttaaacagcgaaacc
gcagtaaaagcatacgaagcaggtgcagacataattattgcgggaggaacattatacaag
tccgcagatcctgaacaaactgcaagagatattgtaaaaagtcttgaaactggaaaacct
gtaaaaacggataaatttaagaaatttaatgaagatgaactgggcagtgcatttgatatt
gtaagtacttcaaatataagtgatgcaatgcacagaaccggggagatgaaaggtttaaaa
ccagtctggaactctgaaagacctttaaaatttgcaggacctgcagttacagttagaact
tactctggagactggagtaaacctgtaagtgcgatagataactgtgaagcaggaaatgtt
ttggtaattgacaactgcagttctgaaattgcctgctggggcggacttgcaacgctttca
tgtaaaaccaaaggcgtagttgcagttgtaatagatggtgctgttagggatgtcgaagaa
attttaaaaattggaattccagtatatgcaagaagtataactccaactgccggagagcca
aaaggttttggagaaataaatgccgtaattgaatgtgcaggaaggactgttgaacctgga
gactggattgtcggggatgaaaatggaattattgtagttccaaaaaatgaggcaatggaa
attgcaaacagggcaatcgatgtaaaagaaagagaagatagggttaaagaagaaataaca
cgtggaacaacgcttgcaaaaacaataagattaaaagattgggaattgaaaaaataa

DBGET integrated database retrieval system