KEGG   Methanococcus maripaludis S2: MMP1512Help
Entry
MMP1512           CDS       T00164                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp01100  Metabolic pathways
mmp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MMP1512 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MMP1512 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mmp01011]
    MMP1512 (alr)
Enzymes [BR:mmp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MMP1512 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mmp01011]
 Precursor biosynthesis
  Racemase
   MMP1512 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CAF31068
UniProt: Q6LX41
LinkDB All DBs
Position
complement(1470522..1471643)
Genome map
AA seq 373 aa AA seqDB search
MVSHPIWAEIDLSAIKNNIKEIRRITNPKSQVMAVVKANAYGHGSVEVSKICLENGADRL
AVARSTEALELRDAGITCPILVFGYVTEEEILKMVENDITLTVYSLEIANSIQKIAEKLG
KHSKIHIKVDTGMSRLGFLPEKSSVETIKKIRELENIEVEGIYTHFADADNSDKTYTTMQ
FSKFTSFLHDLEENGIDIPIKHASNSAAIIDHPETHLNMVRPGIILYGLYPSELVHKERI
NLQPAMSLKVLVTHVKDVPENTKISYGCTFETKKQSKIASLPIGYADGFTRMLRNGNVLI
HGLRVPVVGRICMDQCMIDVTSIENVNVGDVVTVFGKDGTEKISIEEFGNKLGTINYELV
CMVSARVPRIYLH
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtttcacatccgatatgggcagaaattgacttaagcgcaattaaaaacaatattaaa
gaaataagacgaattacaaaccccaaatcccaggtaatggcagtagtaaaagcaaatgct
tacggacacggctcagtcgaggtttcaaaaatatgccttgaaaacggggccgataggtta
gcagttgcacgttcaacggaagctcttgaacttagggatgcaggaataacctgtccaata
cttgtatttggatatgttaccgaagaagaaattttgaaaatggttgaaaatgatataact
ttaaccgtttattcacttgaaatcgcaaattcaatccaaaaaattgctgaaaaattggga
aaacattcaaaaatccatatcaaagtagacaccggaatgagtagacttggatttttgccc
gagaaatcgtcggtagaaaccataaaaaaaatcagggaactggaaaacatcgaagttgaa
ggaatttacacgcattttgcagatgcagataattctgataaaacatacaccactatgcaa
ttttctaaatttacgagttttttacacgatctcgaggaaaatggaattgatattccaata
aaacacgcatcaaatagcgctgcaataattgaccacccggaaacacatctcaatatggta
agacccggaattattctatacgggctttacccttcagaactggtccacaaggaaagaatt
aatttacaacctgcaatgagtttgaaggtacttgtaacgcatgtaaaagacgttccagaa
aatacaaaaataagttatggatgcacttttgaaaccaaaaaacaatcaaaaattgcatca
cttccaatagggtatgccgatggattcacaagaatgttacgaaatgggaatgtcctgatc
catggattgcgggttcctgttgttggcagaatctgcatggatcagtgcatgattgatgtt
acaagtattgaaaacgtaaacgttggagacgttgtcacagtatttggaaaagacggaact
gaaaaaatctccattgaagagtttggtaataaattgggaaccataaattacgaacttgtt
tgcatggtatctgcaagagttccaagaatatatttacattaa

DBGET integrated database retrieval system