KEGG   Methanococcus maripaludis C5: MmarC5_0063Help
Entry
MmarC5_0063       CDS       T00491                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq01100  Metabolic pathways
mmq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MmarC5_0063
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MmarC5_0063
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mmq01011]
    MmarC5_0063
Enzymes [BR:mmq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MmarC5_0063
Peptidoglycan biosynthesis and degradation proteins [BR:mmq01011]
 Precursor biosynthesis
  Racemase
   MmarC5_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABO34380
UniProt: A4FW09
LinkDB All DBs
Position
53721..54842
Genome map
AA seq 373 aa AA seqDB search
MVSHPIWAEIDLSAIKNNIEEIRRITNPKSQVMAVVKANAYGHGAVEVSKVCLENGADRL
AVARSTEALELRNAGITCPILVFGYCTEEEIEKMVENDITLTVYSFETASSIQKTAEKLG
KHPKIHIKVDTGMSRLGFLPRKDAVETIQKIMELENIEVEGIYTHFADADNSDKTYTTLQ
FSRFTNFLHDLEENEIFIPIKHASNSAAIIDHPETHLNLVRPGIILYGLYPSELVHKERI
NLKPAMSLKVLVTHVKEVPENTKISYGCTFETKKPSKIASLPIGYADGFTRMLKNGYVLI
HGSRVPVIGRICMDQCMIDVSYIENVQVGDVVTIFGTQENETIPIEEFGEKLGTINYELV
CMVASRVPRKYLQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtttcacatcctatctgggcagaaattgacttaagcgcaattaaaaacaatattgaa
gaaataagaagaatcacaaaccccaaatctcaagtaatggcagtagtaaaggcaaatgcc
tatggacacggtgcagtagaagtttcaaaagtatgtctcgaaaacggggccgataggttg
gcagttgcacgctcaaccgaagctcttgaactaagaaatgccggaataacgtgtcccata
ctagtatttggttactgtactgaagaagaaattgaaaaaatggttgaaaatgatataact
ttaacagtttattcatttgaaactgcgagttcaattcaaaaaactgccgaaaaattagga
aaacatccaaaaatccatatcaaagtagatacaggaatgagtagacttggatttttgccc
agaaaagatgcggtagaaaccatacaaaaaatcatggaattagaaaatattgaagttgaa
ggaatttacacgcattttgccgatgcagacaattccgataaaacatacactactttgcaa
ttttcaagatttacgaatttcttgcacgatcttgaagaaaatgaaatttttatccccata
aaacatgcatcaaatagtgctgcaataattgatcaccctgaaacacatcttaatctagta
aggccgggaattatcctttatgggctttacccttcagaattagtccataaagaacggatt
aatttaaaacctgcgatgagtttaaaagttctcgtaactcacgtaaaagaagttccagaa
aacacgaaaataagttatggatgcacatttgaaaccaaaaaaccctcaaaaattgcctca
cttccaataggttatgctgatggatttacaagaatgctaaagaacggatacgttttgatt
catggatcaagggttccagttattggcagaatatgtatggatcagtgcatgatcgatgtt
tcatatattgaaaatgttcaagtgggagacgttgttacaatatttggaactcaggaaaat
gaaacaataccaatcgaagagtttggtgaaaaattgggaaccataaattatgaacttgtt
tgtatggtggcaagcagagttccaagaaaatacctacaataa

DBGET integrated database retrieval system